AibGenesis™ Mouse Anti-tmed9 Antibody (CBMOAB-09686FYB)


Cat: CBMOAB-09686FYB

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-09686FYB Monoclonal Zebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Ferret (Mustela Putorius Furo), Frog (Xenopus laevis), Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus), Bovine (Bos taurus), Rhesus (Macaca mulatta) WB, ELISA MO09686FYB 100 µg
CBMOAB-60404FYA Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO60404FYA 100 µg
MO-AB-08505H Monoclonal Frog (Xenopus laevis) WB, ELISA MO08505C 100 µg
MO-AB-14260W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO14260W 100 µg
MO-AB-21747R Monoclonal Cattle (Bos taurus) WB, ELISA MO21747R 100 µg
MO-AB-29515H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO29515C 100 µg
MO-AB-35850W Monoclonal Ferret (Mustela Putorius Furo) WB, ELISA MO35850W 100 µg
MO-DKB-01121W Polyclonal Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus), Bovine (Bos taurus), Rhesus (Macaca mulatta) WB, IHC, IHC-P 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Ferret (Mustela Putorius Furo), Frog (Xenopus laevis), Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus), Bovine (Bos taurus), Rhesus (Macaca mulatta)
CloneMO09686FYB
SpecificityThis antibody binds to Zebrafish tmed9.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationGolgi apparatus; Endoplasmic reticulum; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene is a member of a family of genes encoding transport proteins located in the endoplasmic reticulum and the Golgi. A similar gene in mouse is the target of microRNA miR-296, which is part of an imprinted cluster. (From NCBI)
Product OverviewMouse Anti-Zebrafish tmed9 Antibody is a mouse antibody against tmed9. It can be used for tmed9 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesTmed9 protein; tmed
UniProt IDQ6IQJ4
Protein RefseqThe length of the protein is 226 amino acids long.
The sequence is show below: SVKMVAIRMQFTLYFLVLLNIYNSLVSALYFHIGETEKKCFIEEIPDETMIIGNYRTQLYDKQKEEYLPATQGLGMFVEVKDPDEKVILSRQYGSEGRFIFTSHTPGEHQICLHSNSSKFALFAGGMLRVHLDIQVGEHTNNYAEIAAKDKLTELQLRVRQLMEQVDQIQKEQNYQRYREERFRQTSESTNQRVLWWSIVQTLILVAIGFWQMRHLKSFFEAKKLV.
For Research Use Only | Not For Clinical Use.
Online Inquiry