AibGenesis™ Mouse Anti-tmem101 Antibody (CBMOAB-09696FYB)


Cat: CBMOAB-09696FYB

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-09696FYB Monoclonal Zebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset, Rat (Rattus norvegicus) WB, ELISA MO09696FYB 100 µg
MO-AB-08509H Monoclonal Frog (Xenopus laevis) WB, ELISA MO08509C 100 µg
MO-AB-13651W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO13651W 100 µg
MO-AB-21750R Monoclonal Cattle (Bos taurus) WB, ELISA MO21750R 100 µg
MO-AB-29517H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO29517C 100 µg
MO-AB-66332W Monoclonal Marmoset WB, ELISA MO66332W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset, Rat (Rattus norvegicus)
CloneMO09696FYB
SpecificityThis antibody binds to Zebrafish tmem101.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Zebrafish tmem101 Antibody is a mouse antibody against tmem101. It can be used for tmem101 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative Namestmem101; TMEM101 Gene(Protein Coding) Transmembrane Protein 101
UniProt IDF1QVT0
Protein RefseqThe length of the protein is 256 amino acids long.
The sequence is show below: AMAAATRKKALRFFSQFGAFILTRFGFWNCFAMLMLFAERADVKRKPDIQVPYLYIDLGAAVLCASFMSFGVKRRWFALAAAIHLALSTYVSYVGGQVHYGDWLKVRMYSRAMAIIGGFLILSSGAGEVYRQKPRTRSLQSTGQVFLGIYLICMVYSLQHSKEDRLAYLDHIPGGELTVQLLVLVFGVLALAYLSGCYVRVASQILAVLLPLVILFIDGNFGYWHRSCRVEFWNQMKLIGQNVGIFGAVLILATDS.
For Research Use Only | Not For Clinical Use.
Online Inquiry