AibGenesis™ Mouse Anti-tmem106a Antibody (CBMOAB-09703FYB)


Cat: CBMOAB-09703FYB

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-09703FYB Monoclonal Zebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset WB, ELISA MO09703FYB 100 µg
MO-AB-17872W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO17872W 100 µg
MO-AB-21753R Monoclonal Cattle (Bos taurus) WB, ELISA MO21753R 100 µg
MO-AB-66336W Monoclonal Marmoset WB, ELISA MO66336W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset
CloneMO09703FYB
SpecificityThis antibody binds to Zebrafish tmem106a.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Zebrafish tmem106a Antibody is a mouse antibody against tmem106a. It can be used for tmem106a detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesTmem106a protein; tmem106
UniProt IDQ7ZW67
Protein RefseqThe length of the protein is 282 amino acids long.
The sequence is show below: SRVACAVLQNNLNTNFPNQRDGVNRYSSHNVSMNSRSRWRSLVSPLQKYNIMSQNKNGEKRRLSKWLDYGSINGEGQSDPCPTCQGTGRIPRGQENQLVAVIPCSDQRLKPHHTKLYVCISVGLCLLICSLILFFLFPRSMDMSAVELQSSMVYFTPDSVKIVVTHQMNLTNQNFVSITANNLSVQALIFETVVGKTKFPNVTVLPPRSQKTIKVIADILIDDTGLNNYCKSSAFQIHTLFLHLQLNIKVFYLSHSEEMSTDAYEYIDCGVNSTVPRHFPLV.
For Research Use Only | Not For Clinical Use.
Online Inquiry