AibGenesis™ Mouse Anti-tmem130 Antibody (CBMOAB-09742FYB)


Cat: CBMOAB-09742FYB

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-09742FYB Monoclonal Zebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Rat (Rattus norvegicus), Rhesus (Macaca mulatta) WB, ELISA MO09742FYB 100 µg
MO-AB-06569W Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO06569W 100 µg
MO-AB-13144W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO13144W 100 µg
MO-AB-21774R Monoclonal Cattle (Bos taurus) WB, ELISA MO21774R 100 µg
MO-AB-29529H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO29529C 100 µg
MO-AB-66369W Monoclonal Marmoset WB, ELISA MO66369W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Rat (Rattus norvegicus), Rhesus (Macaca mulatta)
CloneMO09742FYB
SpecificityThis antibody binds to Zebrafish tmem130.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationPlasma Membrane

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Zebrafish tmem130 Antibody is a mouse antibody against tmem130. It can be used for tmem130 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesZgc:174622 protein; tmem13
UniProt IDQ4V9E2
Protein RefseqThe length of the protein is 331 amino acids long.
The sequence is show below: TSCLFGDLCRRVHMDWIRSVLVHTFLSLISSLAFGIPEESPHHQLSGNVKGKLIFHQMEGNSTYLRKTGNLASYTKTVVSFELYDPRHILRSVSFTYTWDLGNGEVHKGPEPFVKFYYALPGNYTLKLSIETDAPQHSRMTGLYSVDLTVLDAIRYVDLIGPVIYNVDQNSRLSFEVGGSPPVWLCWRVLPDCHTPNPASCSLVQIYENTFCLNYTFTSVGTHCLDLSVKNNISSLQTFYSVYVQSGHVSLFFLLPCAAVIVATLIFISVTVCRPRQRSLMCKGDYVSFTDIELRAKDATVPLQSNSSASKTNETQLLLYQQGPSYNPESC.
For Research Use Only | Not For Clinical Use.
Online Inquiry