AibGenesis™ Mouse Anti-TMEM164 Antibody (CBMOAB-60486FYA)


Cat: CBMOAB-60486FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-60486FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset WB, ELISA MO60486FYA 100 µg
MO-AB-06576W Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO06576W 100 µg
MO-AB-21800R Monoclonal Cattle (Bos taurus) WB, ELISA MO21800R 100 µg
MO-AB-24578W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO24578W 100 µg
MO-AB-66411W Monoclonal Marmoset WB, ELISA MO66411W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset
CloneMO60486FYA
SpecificityThis antibody binds to Rhesus TMEM164.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus TMEM164 Antibody is a mouse antibody against TMEM164. It can be used for TMEM164 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesTMEM164
UniProt IDF6WT02
Protein RefseqThe length of the protein is 258 amino acids long.
The sequence is show below: MSRYSYQSLLDWLYGGVDPSFAGNGGPDCAAFLSWQQRLLESVVVLTLALLEILVALRHILRQTKEDGRGSPGSQPEQVTQRPEEGKESLSKNLLLVALCLTFGVEVGFKFATKTVIYLLNPCHLVTMMHLPFELEIYYIQHVMLYVVPIYLLWKGGAYTPEPLSSFRWALLSTGLMFFYHFSVLQILGLVTEVNLNNMLCPAISDPFYGPWYRIWASGHQTLMTMTHGKLVILFSYMAGPLCKYLLDLLRLPAKKID.
For Research Use Only | Not For Clinical Use.
Online Inquiry