AibGenesis™ Mouse Anti-tmem167a Antibody (CBMOAB-09789FYB)
Cat: CBMOAB-09789FYB
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| CBMOAB-09789FYB | Monoclonal | Zebrafish (Danio rerio), Cat (Felis catus), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Elephant (Loxodonta africana), Guinea pig (Cavia porcellus), Horse (Equus caballus), Mallard (Anas platyrhynchos), Marmoset, Medaka (Oryzias latipes), O. anatinus (Ornithorhynchus anatinus), Rabbit (Oryctolagus cuniculus), Rat (Rattus norvegicus), Sheep (Ovis aries) | WB, ELISA | MO09789FYB | 100 µg | ||
| MO-AB-01534L | Monoclonal | Elephant (Loxodonta africana) | WB, ELISA | MO01534L | 100 µg | ||
| MO-AB-01770R | Monoclonal | Medaka (Oryzias latipes) | WB, ELISA | MO01770R | 100 µg | ||
| MO-AB-06948Y | Monoclonal | O. anatinus (Ornithorhynchus anatinus) | WB, ELISA | MO06948Y | 100 µg | ||
| MO-AB-09538W | Monoclonal | Cat (Felis catus) | WB, ELISA | MO09538W | 100 µg | ||
| MO-AB-10241Y | Monoclonal | Rabbit (Oryctolagus cuniculus) | WB, ELISA | MO10241Y | 100 µg | ||
| MO-AB-13839W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO13839W | 100 µg | ||
| MO-AB-18018Y | Monoclonal | Sheep (Ovis aries) | WB, ELISA | MO18018Y | 100 µg | ||
| MO-AB-21801R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO21801R | 100 µg | ||
| MO-AB-23816H | Monoclonal | Mallard (Anas platyrhynchos) | WB, ELISA | MO23816C | 100 µg | ||
| MO-AB-29548H | Monoclonal | Rat (Rattus norvegicus) | WB, ELISA | MO29548C | 100 µg | ||
| MO-AB-33774W | Monoclonal | Dog (Canis lupus familiaris) | WB, ELISA | MO33774W | 100 µg | ||
| MO-AB-42714W | Monoclonal | Guinea pig (Cavia porcellus) | WB, ELISA | MO42714W | 100 µg | ||
| MO-AB-46850W | Monoclonal | Horse (Equus caballus) | WB, ELISA | MO46850W | 100 µg | ||
| MO-AB-66413W | Monoclonal | Marmoset | WB, ELISA | MO66413W | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Zebrafish (Danio rerio), Cat (Felis catus), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Elephant (Loxodonta africana), Guinea pig (Cavia porcellus), Horse (Equus caballus), Mallard (Anas platyrhynchos), Marmoset, Medaka (Oryzias latipes), O. anatinus (Ornithorhynchus anatinus), Rabbit (Oryctolagus cuniculus), Rat (Rattus norvegicus), Sheep (Ovis aries) |
| Clone | MO09789FYB |
| Specificity | This antibody binds to Zebrafish tmem167a. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
| Cellular Localization | Golgi apparatus |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Product Overview | Mouse Anti-Zebrafish tmem167a Antibody is a mouse antibody against tmem167a. It can be used for tmem167a detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | Protein kish; tmem167 |
| UniProt ID | F1Q8K5 |
| Protein Refseq | The length of the protein is 86 amino acids long. The sequence is show below: SAIFNFQSLLTVILLLICTCAYIRSLTPSLLDKNKTGRAQEPVRSVLLHRHGLHHLILRVTSQDLNKMISKNSFETLQQGTRCVFR. |
For Research Use Only | Not For Clinical Use.
Online Inquiry