AibGenesis™ Mouse Anti-tmem170a Antibody (CBMOAB-09796FYB)


Cat: CBMOAB-09796FYB

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-09796FYB Monoclonal Zebrafish (Danio rerio), Cattle (Bos taurus), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), Rat (Rattus norvegicus), Rhesus (Macaca mulatta) WB, ELISA MO09796FYB 100 µg
CBMOAB-60491FYA Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO60491FYA 100 µg
MO-AB-04509Y Monoclonal Chicken (Gallus gallus) WB, ELISA MO04509Y 100 µg
MO-AB-16687W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO16687W 100 µg
MO-AB-21806R Monoclonal Cattle (Bos taurus) WB, ELISA MO21806R 100 µg
MO-AB-29551H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO29551C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Cattle (Bos taurus), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), Rat (Rattus norvegicus), Rhesus (Macaca mulatta)
CloneMO09796FYB
SpecificityThis antibody binds to Zebrafish tmem170a.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus; Endoplasmic reticulum; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Zebrafish tmem170a Antibody is a mouse antibody against tmem170a. It can be used for tmem170a detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesTransmembrane protein 170A; tmem170a; tmem17
UniProt IDA3KPL7
Protein RefseqThe length of the protein is 145 amino acids long.
The sequence is show below: MIEALIVGEMQDVQIGFVKQILSLNLVPRSNNTTCGNNTSLCDFSEMWYGVFLWAVVSSLIFHLPAALLALATLRRHKVARFFPLGILLMGIIGPLFGGVLTSAAIAGVYKAAGKSMFSLEALVFGVGQSLFIFIISFLRILATL.
For Research Use Only | Not For Clinical Use.
Online Inquiry