AibGenesis™ Mouse Anti-tmem170b Antibody (CBMOAB-09797FYB)


Cat: CBMOAB-09797FYB

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-09797FYB Monoclonal Zebrafish (Danio rerio), Marmoset, Rat (Rattus norvegicus), Rhesus (Macaca mulatta) WB, ELISA MO09797FYB 100 µg
CBMOAB-60492FYA Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO60492FYA 100 µg
MO-AB-29552H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO29552C 100 µg
MO-AB-66418W Monoclonal Marmoset WB, ELISA MO66418W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Marmoset, Rat (Rattus norvegicus), Rhesus (Macaca mulatta)
CloneMO09797FYB
SpecificityThis antibody binds to Zebrafish tmem170b.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Zebrafish tmem170b Antibody is a mouse antibody against tmem170b. It can be used for tmem170b detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative Namestmem170b; si:rp71-18l21.2; TMEM170B Gene(Protein Coding) Transmembrane Protein 170B
UniProt IDF1Q5W3
Protein RefseqThe length of the protein is 151 amino acids long.
The sequence is show below: MCPPSSGRFLSRRAALQPPGANMNKDYSINLSVQQVLSLWVQGEATLKHFTEMWYWVFLWCLFSSLFVHSAVGLLMCVTLQRHKRGRLITLVLISVGFLASLGGGVITSAAVAVVYRVAGKDMAPLEALVYGVGQTALTVIISFSRILATL.
For Research Use Only | Not For Clinical Use.
Online Inquiry