AibGenesis™ Mouse Anti-tmem182 Antibody (CBMOAB-09831FYB)


Cat: CBMOAB-09831FYB

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-09831FYB Monoclonal Zebrafish (Danio rerio), Cattle (Bos taurus), Rat (Rattus norvegicus) WB, ELISA MO09831FYB 100 µg
MO-AB-21814R Monoclonal Cattle (Bos taurus) WB, ELISA MO21814R 100 µg
MO-AB-29559H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO29559C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Cattle (Bos taurus), Rat (Rattus norvegicus)
CloneMO09831FYB
SpecificityThis antibody binds to Zebrafish tmem182.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionTMEM182 (Transmembrane Protein 182) may negatively regulate myogenesis and skeletal muscle regeneration. (From uniprot, under CC BY 4.0)
Product OverviewMouse Anti-Zebrafish tmem182 Antibody is a mouse antibody against tmem182. It can be used for tmem182 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesTransmembrane protein 182; tmem18
UniProt IDQ5CZV0
Protein RefseqThe length of the protein is 248 amino acids long.
The sequence is show below: MKIHVAGFFAGLFGALATLFILLSFGTDYWLLASETCNSHLNSPVTSERGDILVNQVHDPNSEAPNITFHHEGFFWRCTFDDVMNDGNLWKFWFENQPHVRVCKPAYLLPFPFPDQSYNTTSYQTAIIYRGFWSVSMLVGVAAVVAGGFIIICAAPFASHRLYKAGGGLYLISGFFVLVVTAMYVIWIDVLDVISLYTEYQKLNKCADFELNKTYGLSFMFAPVGVFFCFLSGLLFLVIGRTVHHQYN.
For Research Use Only | Not For Clinical Use.
Online Inquiry