AibGenesis™ Mouse Anti-TMEM185A Antibody (CBMOAB-60514FYA)
Cat: CBMOAB-60514FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| CBMOAB-60514FYA | Monoclonal | Rhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset | WB, ELISA | MO60514FYA | 100 µg | ||
| MO-AB-06581W | Monoclonal | Rhesus (Macaca mulatta) | WB, ELISA | MO06581W | 100 µg | ||
| MO-AB-08529H | Monoclonal | Frog (Xenopus laevis) | WB, ELISA | MO08529C | 100 µg | ||
| MO-AB-20955W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO20955W | 100 µg | ||
| MO-AB-66435W | Monoclonal | Marmoset | WB, ELISA | MO66435W | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Rhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset |
| Clone | MO60514FYA |
| Specificity | This antibody binds to Rhesus TMEM185A. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | The protein encoded by this gene is predicted to be a transmembrane protein. This gene is best known for localizing to the CpG island of the fragile site FRAXF. The 5' untranslated region of this gene contains a CGG trinucleotide repeat sequence that normally consists of 7-40 tandem CGG repeats but which can expand to greater than 300 repeats. Methylation of the CpG island leads to transcriptional silencing of this gene, but neither the silencing nor an expanded repeat region appear to manifest itself in a clear phenotypic manner. Alternative splicing results in multiple transcript variants. A pseudogene of this gene has been defined on the X chromosome. (From NCBI) |
| Product Overview | Mouse Anti-Rhesus TMEM185A Antibody is a mouse antibody against TMEM185A. It can be used for TMEM185A detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | Putative transmembrane protein 185B; TMEM185A |
| UniProt ID | H9FM89 |
| Protein Refseq | The length of the protein is 79 amino acids long. The sequence is show below: GEACVEFKAMLIAVGIHLLLLMFEVLVCDRVERGTHFWLLVFMPLFFVSPVSVAACVWGFRHDRSLELEILCSVNILQF. |
For Research Use Only | Not For Clinical Use.
Online Inquiry