AibGenesis™ Mouse Anti-TMEM200B Antibody (CBMOAB-60523FYA)


Cat: CBMOAB-60523FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-60523FYA Monoclonal Rhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Marmoset WB, ELISA MO60523FYA 100 µg
MO-AB-25139W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO25139W 100 µg
MO-AB-66448W Monoclonal Marmoset WB, ELISA MO66448W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Marmoset
CloneMO60523FYA
SpecificityThis antibody binds to Rhesus TMEM200B.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus TMEM200B Antibody is a mouse antibody against TMEM200B. It can be used for TMEM200B detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesTMEM200B
UniProt IDF6W832
Protein RefseqThe length of the protein is 325 amino acids long.
The sequence is show below: ADWDPDPRGAAAPGHRPQAGRGQQSGELKLCGPDPEAQGRCCSGRATGHGGLGRRRRERRPGGGLVLVRAVFPVSSSSRSCCSFGAGGGGLEGGGGQGEAGAGDAPSSRAAXSELRREGRGGGRAHGPHERLRLLGPVIMGVGLFVFICANTLLYENRDLETRRLRQGVLRAQALRPPDGPGWDCALLPSPGPRTPRAVGCAEPEIWDPSPRRGTSPVPSVRSLRSEPANPRLGLPALLNSYPLKGPGLPPPWGPRTQTGHVIITVQPSGSCIEHSKSLDLGLGELLLGAPAARDCAHRSWPRLDRLSLGGYAKLGGGGDLGARV.
For Research Use Only | Not For Clinical Use.
Online Inquiry