AibGenesis™ Mouse Anti-tmem203 Antibody (CBMOAB-09872FYB)


Cat: CBMOAB-09872FYB

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-09872FYB Monoclonal Zebrafish (Danio rerio), Chimpanzee (Pan troglodytes), Marmoset, Rat (Rattus norvegicus) WB, ELISA MO09872FYB 100 µg
MO-AB-22905W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO22905W 100 µg
MO-AB-29564H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO29564C 100 µg
MO-AB-66454W Monoclonal Marmoset WB, ELISA MO66454W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Chimpanzee (Pan troglodytes), Marmoset, Rat (Rattus norvegicus)
CloneMO09872FYB
SpecificityThis antibody binds to Zebrafish tmem203.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationEndoplasmic reticulum; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Zebrafish tmem203 Antibody is a mouse antibody against tmem203. It can be used for tmem203 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesZgc:92808; tmem203; zgc:92808; NP_001002519.1;XP_005165547.
UniProt IDQ6DGR1
Protein RefseqThe length of the protein is 140 amino acids long.
The sequence is show below: MLFSLRELVQWLGFATFELFLHLGALLVFSVLVALHMDVDKQTLEMSWWLVFSPLFTADGLSTYFTAIVSIRLYQEGEKRLAVLRLLWVLTVLSLKLVCEVLLCQKLAEQERAQDLWFGLIVSPLFILLQLLMIRACRVN.
For Research Use Only | Not For Clinical Use.
Online Inquiry