AibGenesis™ Mouse Anti-tmem251 Antibody (CBMOAB-09930FYB)


Cat: CBMOAB-09930FYB

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-09930FYB Monoclonal Zebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Rat (Rattus norvegicus), Rhesus (Macaca mulatta) WB, ELISA MO09930FYB 100 µg
CBMOAB-60561FYA Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO60561FYA 100 µg
MO-AB-19647W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO19647W 100 µg
MO-AB-21856R Monoclonal Cattle (Bos taurus) WB, ELISA MO21856R 100 µg
MO-AB-29594H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO29594C 100 µg
MO-AB-66492W Monoclonal Marmoset WB, ELISA MO66492W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Rat (Rattus norvegicus), Rhesus (Macaca mulatta)
CloneMO09930FYB
SpecificityThis antibody binds to Zebrafish tmem251.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionTMEM251 (Transmembrane Protein 251) is required for mannose-6-phosphate-dependent trafficking of lysosomal enzymes. LYSET bridges GlcNAc-1-phosphate transferase (GNPTAB) to the membrane-bound transcription factor site-1 protease (MBTPS1), thus allowing proteolytic activation of GNPTAB. GNPTAB is involved in the regulation of M6P-dependent Golgi-to-lysosome trafficking of lysosomal enzymes. Therefore, LYSET is an essential factor for the maturation and delivery of lysosomal hydrolases. (From uniprot, under CC BY 4.0)
Product OverviewMouse Anti-Zebrafish tmem251 Antibody is a mouse antibody against tmem251. It can be used for tmem251 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesTransmembrane protein 251; tmem25
UniProt IDQ5TZA3
Protein RefseqThe length of the protein is 142 amino acids long.
The sequence is show below: MMNFRQRMGWIGVGLYLLASVAAVYYIFEISQTYNRLALAQVEKTSGAQAKWPGDASSSSPSSTSWIVTLKTRLLLLPFWVWATIFLLPYLQVFLFLYSCTRADPKTVGYCILPICLAVLCNRHQTFTKASNQISRLQLIDT.
For Research Use Only | Not For Clinical Use.
Online Inquiry