AibGenesis™ Mouse Anti-TMEM253 Antibody (CBMOAB-60563FYA)


Cat: CBMOAB-60563FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-60563FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Rat (Rattus norvegicus) WB, ELISA MO60563FYA 100 µg
MO-AB-21857R Monoclonal Cattle (Bos taurus) WB, ELISA MO21857R 100 µg
MO-AB-29596H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO29596C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Rat (Rattus norvegicus)
CloneMO60563FYA
SpecificityThis antibody binds to Rhesus TMEM253.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus TMEM253 Antibody is a mouse antibody against TMEM253. It can be used for TMEM253 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesTMEM253
UniProt IDF7GL78
Protein RefseqThe length of the protein is 204 amino acids long.
The sequence is show below: MEDRAGQQEQERHSLRLEKLQHWARHRQSGHLLVLAVSQLWLAVVVVPLAVSVTCLNSECHMATALPLGPGASGLLTGTVTLELRRAPRLWKVRAMMIFNTFNLILGFIVVVVEVMKTALGPAPTASSQHAGLLVLELSAEAFTLAGVLVSVHALFLLSQRKPGCCRSQSLHYQELQEGFSELEEVPGLENGPTVASTGANERA.
For Research Use Only | Not For Clinical Use.
Online Inquiry