AibGenesis™ Mouse Anti-tmem38a Antibody (CBMOAB-09953FYB)


Cat: CBMOAB-09953FYB

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-09953FYB Monoclonal Zebrafish (Danio rerio), Cattle (Bos taurus), Chicken (Gallus gallus), Marmoset, Rabbit (Oryctolagus cuniculus), Rat (Rattus norvegicus) WB, ELISA MO09953FYB 100 µg
MO-AB-04514Y Monoclonal Chicken (Gallus gallus) WB, ELISA MO04514Y 100 µg
MO-AB-10247Y Monoclonal Rabbit (Oryctolagus cuniculus) WB, ELISA MO10247Y 100 µg
MO-AB-21871R Monoclonal Cattle (Bos taurus) WB, ELISA MO21871R 100 µg
MO-AB-29610H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO29610C 100 µg
MO-AB-66506W Monoclonal Marmoset WB, ELISA MO66506W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Cattle (Bos taurus), Chicken (Gallus gallus), Marmoset, Rabbit (Oryctolagus cuniculus), Rat (Rattus norvegicus)
CloneMO09953FYB
SpecificityThis antibody binds to Zebrafish tmem38a.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus; Endoplasmic reticulum; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionIntracellular monovalent cation channel required for maintenance of rapid intracellular calcium release. Acts as a potassium counter-ion channel that functions in synchronization with calcium release from intracellular stores. Opened by a change of voltage within the sarcoplasmic reticulum lumen. (From uniprot, under CC BY 4.0)
Product OverviewMouse Anti-Zebrafish tmem38a Antibody is a mouse antibody against tmem38a. It can be used for tmem38a detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesTrimeric intracellular cation channel type A; TRIC-A; TRICA; Transmembrane protein 38A; tmem38
UniProt IDQ6P2T0
Protein RefseqThe length of the protein is 295 amino acids long.
The sequence is show below: MEVLDVLNLGEIAQYFSKMAMFPVFDVAYYIVSILYLKYEPGAVEVSRRSPVASWLCAMLYCFGSYILADIMLGVCPIDYFHNNSHILLASAVWYLIFFCPLNLFYKCVAFMPVKLVLVALKEVVRTRKIAAGVHHAHHAYHHGWLIMVITGYVKGSGVALMSNFEQLLRGVWKPETNEVLNMSFPTKASLYGAILFTLQEAHVLPVSKSTLICLFTLFMVSSKVFMTARHSHGSPFALIESWVCHVLFGSPLGTEDAHDHHHAAPAAAPAPLSPAKNKEELSEGTRKRKSKKAE.
For Research Use Only | Not For Clinical Use.
Online Inquiry