AibGenesis™ Mouse Anti-TMEM41A Antibody (CBMOAB-60586FYA)


Cat: CBMOAB-60586FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-60586FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset WB, ELISA MO60586FYA 100 µg
MO-AB-21877R Monoclonal Cattle (Bos taurus) WB, ELISA MO21877R 100 µg
MO-AB-22804W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO22804W 100 µg
MO-AB-66512W Monoclonal Marmoset WB, ELISA MO66512W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset
CloneMO60586FYA
SpecificityThis antibody binds to Rhesus TMEM41A.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus TMEM41A Antibody is a mouse antibody against TMEM41A. It can be used for TMEM41A detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesTMEM41A
UniProt IDF6TTF0
Protein RefseqThe length of the protein is 133 amino acids long.
The sequence is show below: MRPLLGLLLVFAGCTFALYLLSTRLPRGRRLGSTEEAGGRSLWFPSDLAELRELSEVLRDYRKEHQAYVFLLFCSAYLYKQGFAIPGSSFLVSVLPPLLPCFLLLSSSGQHGTPLAYYMDVIPAQSKETRHLI.
For Research Use Only | Not For Clinical Use.
Online Inquiry