AibGenesis™ Mouse Anti-tmem60 Antibody (CBMOAB-10002FYB)


Cat: CBMOAB-10002FYB

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-10002FYB Monoclonal Zebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Horse (Equus caballus), Marmoset, Rat (Rattus norvegicus) WB, ELISA MO10002FYB 100 µg
MO-AB-08556H Monoclonal Frog (Xenopus laevis) WB, ELISA MO08556C 100 µg
MO-AB-21895R Monoclonal Cattle (Bos taurus) WB, ELISA MO21895R 100 µg
MO-AB-22765W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO22765W 100 µg
MO-AB-29620H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO29620C 100 µg
MO-AB-46855W Monoclonal Horse (Equus caballus) WB, ELISA MO46855W 100 µg
MO-AB-66529W Monoclonal Marmoset WB, ELISA MO66529W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Horse (Equus caballus), Marmoset, Rat (Rattus norvegicus)
CloneMO10002FYB
SpecificityThis antibody binds to Zebrafish tmem60.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Zebrafish tmem60 Antibody is a mouse antibody against tmem60. It can be used for tmem60 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative Namestmem60; TMEM60 Gene(Protein Coding) Transmembrane Protein 60
UniProt IDE9QBF5
Protein RefseqThe length of the protein is 141 amino acids long.
The sequence is show below: MDLHPHLPHHAGPQVGPEDRLELVPHFPSHLDLRSDPAPHAHCQNGRSMQTRLRPSQWSGELEEACLVPYRHAAKTGLLSDALCQIRKPNGHHGELGVHSFMGFAHRCYGGTGIQRFSLQKRLNSGTVLSGSLYFSGVKSS.
For Research Use Only | Not For Clinical Use.
Online Inquiry