AibGenesis™ Mouse Anti-tmem9 Antibody (CBMOAB-10043FYB)


Cat: CBMOAB-10043FYB

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-10043FYB Monoclonal Zebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Rat (Rattus norvegicus), Rhesus (Macaca mulatta) WB, ELISA MO10043FYB 100 µg
MO-AB-06609W Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO06609W 100 µg
MO-AB-19237W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO19237W 100 µg
MO-AB-21916R Monoclonal Cattle (Bos taurus) WB, ELISA MO21916R 100 µg
MO-AB-29635H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO29635C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Rat (Rattus norvegicus), Rhesus (Macaca mulatta)
CloneMO10043FYB
SpecificityThis antibody binds to Zebrafish tmem9.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Zebrafish tmem9 Antibody is a mouse antibody against tmem9. It can be used for tmem9 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative Namestmem9; TMEM9 Gene(Protein Coding) Transmembrane Protein 9
UniProt IDB0S6L8
Protein RefseqThe length of the protein is 193 amino acids long.
The sequence is show below: MYYFTGVMSFIAQSLRTPVIFLAFLVLIEVVSFASADKSFEDVRCKCICPPYRNITGHIYKKNVTQKDCNCLHVVEPMPVPGHDVEAYCLLCECKYEERSSNTIKVTIIIYLSVVGALLLYMLFLLLIDPLIRKHDPYTMPLQNEEDSEDVRPRVDGARGNTVLERVEGAQQRWKKQVQEQRKTVFDRHKLLS.
For Research Use Only | Not For Clinical Use.
Online Inquiry