AibGenesis™ Mouse Anti-tmie Antibody (CBMOAB-10057FYB)


Cat: CBMOAB-10057FYB

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-10057FYB Monoclonal Zebrafish (Danio rerio), Marmoset, Rat (Rattus norvegicus), Rhesus (Macaca mulatta) WB, ELISA MO10057FYB 100 µg
CBMOAB-60664FYA Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO60664FYA 100 µg
MO-AB-29643H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO29643C 100 µg
MO-AB-66569W Monoclonal Marmoset WB, ELISA MO66569W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Marmoset, Rat (Rattus norvegicus), Rhesus (Macaca mulatta)
CloneMO10057FYB
SpecificityThis antibody binds to Zebrafish tmie.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a transmembrane inner ear protein. Studies in mouse suggest that this gene is required for normal postnatal maturation of sensory hair cells in the cochlea, including correct development of stereocilia bundles. This gene is one of multiple genes responsible for recessive non-syndromic deafness (DFNB), also known as autosomal recessive nonsyndromic hearing loss (ARNSHL), the most common form of congenitally acquired inherited hearing impairment. (From NCBI)
Product OverviewMouse Anti-Zebrafish tmie Antibody is a mouse antibody against tmie. It can be used for tmie detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative Namestmie; TMIE Gene(Protein Coding) Transmembrane Inner Ear
UniProt IDF1QA80
Protein RefseqThe length of the protein is 231 amino acids long.
The sequence is show below: MRRGRRRGKMAMEGPGNQPPSLVPLLMSVTAVLISHHFFNAAAQIPDPELLPTDPPKKPDPVTSETVVFWGLRLWQVVGIFSMFILAIIITLCCIFKCRIPRTKKEIEARHAQRLAAKNYANTLETVPPLNELTEVPGAAKVEVKEEVPTVAGKVDGEKEKKKKEKESKKEGKGAKEGKEEEKEEPAKKKGEKGEKGEKGAPKKEASDGGKGKKGGEKAEEKGGAKKPAKK.
For Research Use Only | Not For Clinical Use.
Online Inquiry