AibGenesis™ Mouse Anti-TOM5 Antibody (CBMOAB-04543CR)
Cat: CBMOAB-04543CR
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Yeast, A. thaliana (Arabidopsis thaliana) |
| Clone | MO04543CR |
| Specificity | This antibody binds to Yeast TOM5. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
| Cellular Localization | Mitochondrion |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | Component of the TOM (translocase of outer membrane) receptor complex responsible for the recognition and translocation of cytosolically synthesized mitochondrial preproteins. TOM5 is involved in insertion of preproteins into the TOM40 translocation pore. (From uniprot, under CC BY 4.0) |
| Product Overview | Mouse Anti-Yeast TOM5 Antibody is a mouse antibody against TOM5. It can be used for TOM5 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | Mitochondrial import receptor subunit TOM5; Translocase of outer membrane 5 kDa subunit; TOM5; MOM8A; YPR133W-A |
| UniProt ID | P80967 |
| Protein Refseq | The length of the protein is 50 amino acids long. The sequence is show below: MFGLPQQEVSEEEKRAHQEQTEKTLKQAAYVAAFLWVSPMIWHLVKKQWK. |
For Research Use Only | Not For Clinical Use.
Online Inquiry