AibGenesis™ Mouse Anti-TOM6 Antibody (CBMOAB-04544CR)


Cat: CBMOAB-04544CR

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-04544CR Monoclonal Yeast, A. thaliana (Arabidopsis thaliana) WB, ELISA MO04544CR 100 µg
Inquiry
CBMOAB-45182FYC Monoclonal A. thaliana (Arabidopsis thaliana) WB, ELISA MO45182FC 100 µg
Inquiry

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityYeast, A. thaliana (Arabidopsis thaliana)
CloneMO04544CR
SpecificityThis antibody binds to Yeast TOM6.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationMitochondrion; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionComponent of the TOM (translocase of outer membrane) receptor complex responsible for the recognition and translocation of cytosolically synthesized mitochondrial preproteins. TOM6 is involved in assembly and stability of the TOM complex. (From uniprot, under CC BY 4.0)
Product OverviewMouse Anti-Yeast TOM6 Antibody is a mouse antibody against TOM6. It can be used for TOM6 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesMitochondrial import receptor subunit TOM6; Mitochondrial import site protein ISP6; Translocase of outer membrane 6 kDa subunit; TOM6; ISP6; YOR045W
UniProt IDP33448
Protein RefseqThe length of the protein is 61 amino acids long. The sequence is show below: MDGMFAMPGAAAGAASPQQPKSRFQAFKESPLYTIALNGAFFVAGVAFIQSPLMDMLAPQL.
For Research Use Only | Not For Clinical Use.
Online Inquiry