AibGenesis™ Mouse Anti-TOM6 Antibody (CBMOAB-04544CR)
Cat: CBMOAB-04544CR

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Yeast, A. thaliana (Arabidopsis thaliana) |
| Clone | MO04544CR |
| Specificity | This antibody binds to Yeast TOM6. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
| Cellular Localization | Mitochondrion; Other locations |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | Component of the TOM (translocase of outer membrane) receptor complex responsible for the recognition and translocation of cytosolically synthesized mitochondrial preproteins. TOM6 is involved in assembly and stability of the TOM complex. (From uniprot, under CC BY 4.0) |
| Product Overview | Mouse Anti-Yeast TOM6 Antibody is a mouse antibody against TOM6. It can be used for TOM6 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | Mitochondrial import receptor subunit TOM6; Mitochondrial import site protein ISP6; Translocase of outer membrane 6 kDa subunit; TOM6; ISP6; YOR045W |
| UniProt ID | P33448 |
| Protein Refseq | The length of the protein is 61 amino acids long. The sequence is show below: MDGMFAMPGAAAGAASPQQPKSRFQAFKESPLYTIALNGAFFVAGVAFIQSPLMDMLAPQL. |
For Research Use Only | Not For Clinical Use.
Online Inquiry