Mouse Anti-Tomato acs Antibody (MO-AB-34094H)


Cat: MO-AB-34094H
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityTomato (Lycopersicon esculentum)
CloneMO34094C
SpecificityThis antibody binds to Tomato acs.
FormatLyophilized
StorageStore at 4°C: short-term (1-2 weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewThis product is a mouse antibody against acs. It can be used for acs detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesPutative 1-aminocyclopropane-1-carboxylate synthase; EC 4.4.1.14; acs
UniProt IDQ70XT1
Protein RefseqThe length of the protein is 275 amino acids long.
The sequence is show below: FQDYHGLPEFRKAIAKFMEKTRGGRVRFDPERVVMAGGATGANETIIFCLADPGDAFLVPSPYYPVFNRDLRWRTGVQLIPIHCESSNNFKITSKAVKEAYENAQKSNIKVKGLILTNPSNPLGTTLDKDTLKSVLSFTNQHNIHLVCDEIYAATVFDTPQFVSIAEILDEQEITYCNKDLVHIVYSLSKDMGLPGFRVGIIYSFNDDVVNCARKMSSFGLVSTQTQYFLAAMLSDEKFVDNFLRESAMRLGKRHKGLEVVGIKCLKNNAGLFCW.
For Research Use Only | Not For Clinical Use.

Online Inquiry