AibGenesis™ Mouse Anti-tomm40l Antibody (CBMOAB-10355FYB)


Cat: CBMOAB-10355FYB

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-10355FYB Monoclonal Zebrafish (Danio rerio), Chimpanzee (Pan troglodytes), Marmoset WB, ELISA MO10355FYB 100 µg
MO-AB-18064W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO18064W 100 µg
MO-AB-66685W Monoclonal Marmoset WB, ELISA MO66685W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Chimpanzee (Pan troglodytes), Marmoset
CloneMO10355FYB
SpecificityThis antibody binds to Zebrafish tomm40l.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationMitochondrion

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Zebrafish tomm40l Antibody is a mouse antibody against tomm40l. It can be used for tomm40l detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesTranslocase of outer mitochondrial membrane 40 homolog, like; tomm40
UniProt IDQ6NWH3
Protein RefseqThe length of the protein is 338 amino acids long.
The sequence is show below: MGSVLAASAPSPPPPGPGAPGLVSVPPGFTMPPVSPVSAPSSSPTGQQDTEPPLPNPGGFEECHRKCKEVFPVQMEGVRLTVNKGLSNHFQVNHTVLLSTQADSSYRFGATYVGTKQTGPGEAFPVMVGDMDNTGSLNAQVIHQITDKVRSKFVFQTQQQKFVNWQGDTEFKGEDFTAAVTFGNPDVLMGSGIVVAHYLQSVTSSLALGGELVYHRRPGEEGTVMSLAGRYTGSNFIATLTLGGAGVHASYYHKANDQLQVGVEYEVSTRMQDTSVTFGYQLDVPKANLVFKGSLDSNWVVGANLEKKLQPLPLSLALSAYLDHRKHKFQCGFGITIG.
For Research Use Only | Not For Clinical Use.
Online Inquiry