AibGenesis™ Mouse Anti-tox2 Antibody (CBMOAB-10402FYB)


Cat: CBMOAB-10402FYB

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-10402FYB Monoclonal Zebrafish (Danio rerio), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset, Rhesus (Macaca mulatta) WB, ELISA MO10402FYB 100 µg
CBMOAB-60873FYA Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO60873FYA 100 µg
MO-AB-06660W Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO06660W 100 µg
MO-AB-08631H Monoclonal Frog (Xenopus laevis) WB, ELISA MO08631C 100 µg
MO-AB-15488W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO15488W 100 µg
MO-AB-66711W Monoclonal Marmoset WB, ELISA MO66711W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset, Rhesus (Macaca mulatta)
CloneMO10402FYB
SpecificityThis antibody binds to Zebrafish tox2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Zebrafish tox2 Antibody is a mouse antibody against tox2. It can be used for tox2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesZgc:77466; tox2; zgc:7746
UniProt IDQ6NXC9
Protein RefseqThe length of the protein is 388 amino acids long.
The sequence is show below: MYMSENNQEFLSPTQSYSGQGGGSGGGGGGGDEDYEIPPITPPNHPEPPLLHLMDPESSYLCHSIPHNGLINPYSYPELPALMMTNMLAQDGHLLSSQMPSITGEKRPSSDMMKPKPKPQKKKKKKDPNEPQKPVSAYALFFRDTQAAIKGQNPNATFGDVSKIVASMWDSLGEEQKQAYKRKTEAAKKEYLKALAAYRASLVSKTYSDPVESKSAQSSQPSSHMMPPNAPLYSVPPQPSSPYLGPSPFPLSDLQSYAAGAPRHGLPRSAMLPALSASPPASFQISPPLHQQLSLHQGSILNQPIRMQQVQSHQMSLQAPLHSPPPGQQGFSHLQSEYQKSVGGSQSPGAPNPGGQNPDWDSEYCNRECGGNHCSGSMIGRDKPLYLT.
For Research Use Only | Not For Clinical Use.
Online Inquiry