AibGenesis™ Mouse Anti-tra2a Antibody (CBMOAB-10559FYB)


Cat: CBMOAB-10559FYB

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-10559FYB Monoclonal Zebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Horse (Equus caballus), Marmoset, Medaka (Oryzias latipes), Rhesus (Macaca mulatta) WB, ELISA MO10559FYB 100 µg
CBMOAB-60967FYA Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO60967FYA 100 µg
MO-AB-01793R Monoclonal Medaka (Oryzias latipes) WB, ELISA MO01793R 100 µg
MO-AB-08672H Monoclonal Frog (Xenopus laevis) WB, ELISA MO08672C 100 µg
MO-AB-22099R Monoclonal Cattle (Bos taurus) WB, ELISA MO22099R 100 µg
MO-AB-23468W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO23468W 100 µg
MO-AB-46900W Monoclonal Horse (Equus caballus) WB, ELISA MO46900W 100 µg
MO-AB-66788W Monoclonal Marmoset WB, ELISA MO66788W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Horse (Equus caballus), Marmoset, Medaka (Oryzias latipes), Rhesus (Macaca mulatta)
CloneMO10559FYB
SpecificityThis antibody binds to Zebrafish tra2a.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene is a member of the transformer 2 homolog family and encodes a protein with several RRM (RNA recognition motif) domains. This phosphorylated nuclear protein binds to specific RNA sequences and plays a role in the regulation of pre-mRNA splicing. Alternatively spliced transcript variants have been found for this gene. (From NCBI)
Product OverviewMouse Anti-Zebrafish tra2a Antibody is a mouse antibody against tra2a. It can be used for tra2a detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesTransformer-2 alpha; tra2
UniProt IDQ7T2A0
Protein RefseqThe length of the protein is 297 amino acids long.
The sequence is show below: MSDTEEQQFQRRESRSASKSDRGSPAQPKMESRSGSPSPSRASKRSDSRSRSRSKSRSRSRRHSNRRYSRSRSHSHRKKSRSRSYSPESRRRRSRSASPNSNRRKHAGSRSSYSHDSKKDSHNQGDARANPDPNTCLGVFGLSLYTTERDLREVFSRYGSLAGVNVVYDQRTGRSRGFAFVYFEHIDDAKEAMERANGMELDGRRIRVDYSITKRPHTPTPGIYMGRPTHNGGGGGGGGSSSGGRRRDSYYDRGYDRGYDRGYDEYDYRYSRRRSPSPYYSRYRSRSRSRSYSPRRY.
For Research Use Only | Not For Clinical Use.
Online Inquiry