AibGenesis™ Mouse Anti-TRERF1 Antibody (CBMOAB-61086FYA)


Cat: CBMOAB-61086FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-61086FYA Monoclonal Rhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Marmoset WB, ELISA MO61086FYA 100 µg
MO-AB-17542W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO17542W 100 µg
MO-AB-66848W Monoclonal Marmoset WB, ELISA MO66848W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Marmoset
CloneMO61086FYA
SpecificityThis antibody binds to Rhesus TRERF1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a zinc-finger transcriptional regulating protein which interacts with CBP/p300 to regulate the human gene CYP11A1. Alternative splicing results in multiple transcript variants encoding different isoforms. (From NCBI)
Product OverviewMouse Anti-Rhesus TRERF1 Antibody is a mouse antibody against TRERF1. It can be used for TRERF1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesTranscriptional-regulating factor 1; TRERF1
UniProt IDH9FLF5
Protein RefseqThe length of the protein is 105 amino acids long.
The sequence is show below: IDGSNVTVTPGPGEQTVDVEPRINIGLRFQAEIPELQDISALAQDTHKATLVWKPWPELENHDLQQRVENLLHLCCSSALPGGGTNSEFALHSLFEAKGDVMVAL.
For Research Use Only | Not For Clinical Use.
Online Inquiry