AibGenesis™ Mouse Anti-trim47 Antibody (CBMOAB-10759FYB)


Cat: CBMOAB-10759FYB

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-10759FYB Monoclonal Zebrafish (Danio rerio), Chimpanzee (Pan troglodytes), Marmoset, Rhesus (Macaca mulatta) WB, ELISA MO10759FYB 100 µg
CBMOAB-61133FYA Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO61133FYA 100 µg
MO-AB-14891W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO14891W 100 µg
MO-AB-66891W Monoclonal Marmoset WB, ELISA MO66891W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Chimpanzee (Pan troglodytes), Marmoset, Rhesus (Macaca mulatta)
CloneMO10759FYB
SpecificityThis antibody binds to Zebrafish trim47.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Zebrafish trim47 Antibody is a mouse antibody against trim47. It can be used for trim47 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesZgc:56368; trim47; zgc:5636
UniProt IDQ7ZU70
Protein RefseqThe length of the protein is 479 amino acids long.
The sequence is show below: MATAGDSRGELQKELVCSICLDYFDDPVILKCGHNFCRMCILMHWEENGGDDVGYQCPECRMVFAKMSFTKNYLVKNLVDKLSDFDYLKTCRPSAPAKPVKMDGKCERHHEELKLYCHTDRKPICVVCRESRAHRHHDVAPVPEVVEDMKSELKLRLIKLNWQKSMCTRVKSTDEQAKTDVKLKKQALKEKIEDDVGALVQFLLDEKDDLLERLEAEVVATIGVIDANLKRVESEAAKVDKAITEIQNQLSDSANFETISNSYLSPCHVNLSVQSSNSPPDFSEFTGPFQLIMWKKMMHVLHTMPQNLTLDLDTAHPSLAISDFDTKVEEGRVRSQEPDMPQRFTRFFGVLATAQYANGQHYWEVDVRDKGVWYLGVTTEYSNRKGFVNLSPSAGYWSLCLQDRLYANEEDSRVPVADYWNSPRVGVFLDYDRGHVTFFDAVTMKRIYNFVTYFDEPVSPFFSPGKNDPGSRLQICHFY.
For Research Use Only | Not For Clinical Use.
Online Inquiry