AibGenesis™ Mouse Anti-triqk Antibody (CBMOAB-10808FYB)
Cat: CBMOAB-10808FYB
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| CBMOAB-10808FYB | Monoclonal | Zebrafish (Danio rerio), Chimpanzee (Pan troglodytes), Marmoset, Rat (Rattus norvegicus) | WB, ELISA | MO10808FYB | 100 µg | ||
| MO-AB-18226W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO18226W | 100 µg | ||
| MO-AB-29769H | Monoclonal | Rat (Rattus norvegicus) | WB, ELISA | MO29769C | 100 µg | ||
| MO-AB-66917W | Monoclonal | Marmoset | WB, ELISA | MO66917W | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Zebrafish (Danio rerio), Chimpanzee (Pan troglodytes), Marmoset, Rat (Rattus norvegicus) |
| Clone | MO10808FYB |
| Specificity | This antibody binds to Zebrafish triqk. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
| Cellular Localization | Endoplasmic reticulum; Other locations |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | TRIQK (Triple QxxK/R Motif Containing) may play a role in cell growth and maintenance of cell morphology. (From uniprot, under CC BY 4.0) |
| Product Overview | Mouse Anti-Zebrafish triqk Antibody is a mouse antibody against triqk. It can be used for triqk detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | Triple QxxK/R motif-containing protein; Triple repetitive-sequence of QXXK/R protein homolog; triq |
| UniProt ID | A5WVU9 |
| Protein Refseq | The length of the protein is 84 amino acids long. The sequence is show below: MGKKDASSVKLPVDQYRKQIGKQDYKKTKPVLRATRLKAEAKRSAPGIRDIILVIVAVLLFLLGVYAFFYLNLSTELDLDVDMD. |
For Research Use Only | Not For Clinical Use.
Online Inquiry