AibGenesis™ Mouse Anti-triqk Antibody (CBMOAB-10808FYB)


Cat: CBMOAB-10808FYB

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-10808FYB Monoclonal Zebrafish (Danio rerio), Chimpanzee (Pan troglodytes), Marmoset, Rat (Rattus norvegicus) WB, ELISA MO10808FYB 100 µg
MO-AB-18226W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO18226W 100 µg
MO-AB-29769H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO29769C 100 µg
MO-AB-66917W Monoclonal Marmoset WB, ELISA MO66917W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Chimpanzee (Pan troglodytes), Marmoset, Rat (Rattus norvegicus)
CloneMO10808FYB
SpecificityThis antibody binds to Zebrafish triqk.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationEndoplasmic reticulum; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionTRIQK (Triple QxxK/R Motif Containing) may play a role in cell growth and maintenance of cell morphology. (From uniprot, under CC BY 4.0)
Product OverviewMouse Anti-Zebrafish triqk Antibody is a mouse antibody against triqk. It can be used for triqk detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesTriple QxxK/R motif-containing protein; Triple repetitive-sequence of QXXK/R protein homolog; triq
UniProt IDA5WVU9
Protein RefseqThe length of the protein is 84 amino acids long.
The sequence is show below: MGKKDASSVKLPVDQYRKQIGKQDYKKTKPVLRATRLKAEAKRSAPGIRDIILVIVAVLLFLLGVYAFFYLNLSTELDLDVDMD.
For Research Use Only | Not For Clinical Use.
Online Inquiry