AibGenesis™ Mouse Anti-trir Antibody (MO-AB-08732H)


Cat: MO-AB-08732H

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-08732H Monoclonal Frog (Xenopus laevis), Chimpanzee (Pan troglodytes), Rat (Rattus norvegicus) WB, ELISA MO08732C 100 µg
MO-AB-10997W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO10997W 100 µg
MO-AB-29770H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO29770C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFrog (Xenopus laevis), Chimpanzee (Pan troglodytes), Rat (Rattus norvegicus)
CloneMO08732C
SpecificityThis antibody binds to Frog trir.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewThis product is a mouse antibody against trir. It can be used for trir detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesMGC115545 protein; MGC115545
UniProt IDQ4V7M5
Protein RefseqThe length of the protein is 239 amino acids long.
The sequence is show below: MAETQCEVTEEDSEAEEEGEEAAEAPAQQREAKKPVDIPVAGKYKGATDRGSVLPPRDTAPKPLSTGLLPPPPSLASKRPSPLPVSATPVPRPSPAAMYRGGEPLYSSPVAPPAPPAQALSSGINLFANDGSFMELFKKQMEAKAGEGSSSAASSAGEGQKNAEKSAEAEKRRPISIVGKRRGGAKLALKTGIVTKKPKNEEDEVVSNKGGAWAQYMAEVKKYKAHQCSDDDKTRPLVK.
For Research Use Only | Not For Clinical Use.
Online Inquiry