AibGenesis™ Mouse Anti-trit1 Antibody (CBMOAB-10810FYB)


Cat: CBMOAB-10810FYB

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-10810FYB Monoclonal Zebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Rhesus (Macaca mulatta) WB, ELISA MO10810FYB 100 µg
CBMOAB-61193FYA Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO61193FYA 100 µg
MO-AB-13885W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO13885W 100 µg
MO-AB-22198R Monoclonal Cattle (Bos taurus) WB, ELISA MO22198R 100 µg
MO-AB-66918W Monoclonal Marmoset WB, ELISA MO66918W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Rhesus (Macaca mulatta)
CloneMO10810FYB
SpecificityThis antibody binds to Zebrafish trit1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationMitochondrion

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a protein that that is targeted to the mitochondrion and modifies transfer RNAs (tRNAs) by adding a dimethylallyl group onto the adenine at position 37. This modification is important for maintaining the correct reading frame during protein translation. This gene is considered a tumor suppressor and its expression can decrease cell growth. Alternative splicing results in multiple transcripts variants, most of which are likely non-functional. (From NCBI)
Product OverviewMouse Anti-Zebrafish trit1 Antibody is a mouse antibody against trit1. It can be used for trit1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative Namestrit1; TRIT1 Gene(Protein Coding) TRNA Isopentenyltransferase 1
UniProt IDF1Q4Z4
Protein RefseqThe length of the protein is 455 amino acids long.
The sequence is show below: MAAATRVLQKGIKPSLVVILGATGTGKSKLAIEIGKRLNGEIISADSMQVYKGLDIITNKVTEEEQAQCHHHMISFVDPLVSGYTVVDFRNKALSLISFNACFRIQNMHHRKKLPVIVGGTNYYIESILWKVLIDTGQGSDTEPEKGGGADSRAGLEKLGGPELHRRLKEVDPDMAAILHPHDSRKIARSLQVYMDTGVPHSRLLEEQRGQDGGDCLGGPLRFQDPCIFWLNGKTNVLDERLDKRVDQMLSLGLIDELKDFHLRFNEKMIKESSQNYQHGIFQSIGFKEFHEYLTTSENISQEERDKLMNKGIESLKQVTRRYARKQNKWVRNRFLKRPASNVPPVYGLDVTDVTNWETTVLTPALEILDCLQKGEQPSAQPIKAEGVESRNKRSHHMCDLCEKVIIGDLEWTAHQKSKNHLYQVRKKRKSEQATDLDTKHAKHQNDCDKQVPAL.
For Research Use Only | Not For Clinical Use.
Online Inquiry