AibGenesis™ Mouse Anti-TRMT5 Antibody (MO-AB-35880W)
Cat: MO-AB-35880W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| MO-AB-35880W | Monoclonal | Ferret (Mustela Putorius Furo), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Gorilla, Hamsters (Cricetinae), Marmoset, Medaka (Oryzias latipes), Nile tilapia (Oreochromis niloticus), O. mykiss (Oncorhynchus mykiss), Pig (Sus scrofa), Rabbit (Oryctolagus cuniculus), Sheep (Ovis aries), Zebrafish (Danio rerio) | WB, ELISA | MO35880W | 100 µg | ||
| CBMOAB-10841FYB | Monoclonal | Zebrafish (Danio rerio) | WB, ELISA | MO10841FYB | 100 µg | ||
| MO-AB-26173W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO26173W | 100 µg | ||
| MO-AB-38783W | Monoclonal | Gorilla | WB, ELISA | MO38783W | 100 µg | ||
| MO-AB-43487W | Monoclonal | Hamsters (Cricetinae) | WB, ELISA | MO43487W | 100 µg | ||
| MO-AB-66932W | Monoclonal | Marmoset | WB, ELISA | MO66932W | 100 µg | ||
| MO-AB-22209R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO22209R | 100 µg | ||
| MO-AB-01809R | Monoclonal | Medaka (Oryzias latipes) | WB, ELISA | MO01809R | 100 µg | ||
| MO-AB-30982R | Monoclonal | Pig (Sus scrofa) | WB, ELISA | MO30982R | 100 µg | ||
| MO-AB-08740H | Monoclonal | Frog (Xenopus laevis) | WB, ELISA | MO08740C | 100 µg | ||
| MO-AB-33931H | Monoclonal | Nile tilapia (Oreochromis niloticus) | WB, ELISA | MO33931C | 100 µg | ||
| MO-AB-10318Y | Monoclonal | Rabbit (Oryctolagus cuniculus) | WB, ELISA | MO10318Y | 100 µg | ||
| MO-AB-13532Y | Monoclonal | O. mykiss (Oncorhynchus mykiss) | WB, ELISA | MO13532Y | 100 µg | ||
| MO-AB-18064Y | Monoclonal | Sheep (Ovis aries) | WB, ELISA | MO18064Y | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Ferret (Mustela Putorius Furo), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Gorilla, Hamsters (Cricetinae), Marmoset, Medaka (Oryzias latipes), Nile tilapia (Oreochromis niloticus), O. mykiss (Oncorhynchus mykiss), Pig (Sus scrofa), Rabbit (Oryctolagus cuniculus), Sheep (Ovis aries), Zebrafish (Danio rerio) |
| Clone | MO35880W |
| Specificity | This antibody binds to Ferret TRMT5. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
| Cellular Localization | Mitochondrion; Nucleus; Other locations |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | Involved in mitochondrial tRNA methylation. Specifically methylates the N1 position of guanosine-37 in various tRNAs. Methylation is not dependent on the nature of the nucleoside 5' of the target nucleoside. This is the first step in the biosynthesis of wybutosine (yW), a modified base adjacent to the anticodon of tRNAs and required for accurate decoding. (From uniprot, under CC BY 4.0) |
| Product Overview | Mouse Anti-Ferret TRMT5 Antibody is a mouse antibody against TRMT5. It can be used for TRMT5 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | tRNA (guanine(37)-N1)-methyltransferase; EC 2.1.1.228; M1G-methyltransferase; tRNA [GM37] methyltransferase; tRNA methyltransferase 5 homolog; TRMT5; TRM5 |
| UniProt ID | M3Y4X9 |
| Protein Refseq | The length of the protein is 597 amino acids long. The sequence is show below: MLLAGRLPDPSGRYHPNPPVVSHVGGGAVGPALPGFRTSFSEAKKGGSRRDLMTLVSWWRTVMMSSRASLSTSDPFPTRTRACEGCSLGVSRGAKPGIGMVTLVRWILPRPFGFSRILFKVENCRISESESLTPLSWTSQIQKHSRAPFLLDQRKKFSTMPEIETDQRDSELFSPPSNVRGMTKLDRTAFKKTVTIPVLKVRKEIVDKLMRSLKRAALQRPGIKRVIEDPEDEESRLIMLDPYKIFTDDSFERAELSILKQLNVNPQISKYSLELTYENFKSEEILKAVLPEGQDVTSGFSRVGHIAHLNLRDHQLPFKHLIGQVMIDKNPGITSAVNKINNIDNTYRNFQMEVLSGEENMMTKVRENSHTYEFDFSKVYWNPRLSTEHSRITELLKPGDVLFDVFAGVGPFAVPAAKKNCTVFANDLNPESHKWLLHNCKLNKVDQKVKVFNLDGKDFLQGPVREELMQQLGPLSKERKHSVHIVMNLPAKAIEFLSVFKSLLDGPPCSTELLPIVHCYSFSKDPNPAKDVQQQAGAVLGISLEACSSIHPVRNVAPNKEMLCITFRIPAAVLYKNQTLNLENHDDPPLKRQRTEK. |
See other products for " TRMT5 "
For Research Use Only | Not For Clinical Use.
Online Inquiry