AibGenesis™ Mouse Anti-tsen2 Antibody (CBMOAB-10987FYB)


Cat: CBMOAB-10987FYB

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-10987FYB Monoclonal Zebrafish (Danio rerio), Cattle (Bos taurus), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), Rhesus (Macaca mulatta) WB, ELISA MO10987FYB 100 µg
CBMOAB-61305FYA Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO61305FYA 100 µg
MO-AB-04604Y Monoclonal Chicken (Gallus gallus) WB, ELISA MO04604Y 100 µg
MO-AB-06735W Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO06735W 100 µg
MO-AB-11588W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO11588W 100 µg
MO-AB-22267R Monoclonal Cattle (Bos taurus) WB, ELISA MO22267R 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Cattle (Bos taurus), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), Rhesus (Macaca mulatta)
CloneMO10987FYB
SpecificityThis antibody binds to Zebrafish tsen2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes one of the subunits of the tRNA splicing endonuclease. This endonuclease catalyzes the first step in RNA splicing which is the removal of introns. Mutations in this gene have been associated with pontocerebellar hypoplasia type 2. A pseudogene has been identified on chromosome 4. Multiple transcript variants encoding different isoforms have been found for this gene. (From NCBI)
Product OverviewMouse Anti-Zebrafish tsen2 Antibody is a mouse antibody against tsen2. It can be used for tsen2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesZgc:154067; tsen2; zgc:15406
UniProt IDQ08BW3
Protein RefseqThe length of the protein is 438 amino acids long.
The sequence is show below: MTDAVFQAPKRRARVYECFEAALPVPLNSADDGDHTLLCRAEIIGHHVSVTDPAHIQQLYHRGYFGKGVFSRSRPEHMISPQWKYVGDRCLPVISLSEYQKRLSLARAALVMQDLEEESVNKALQILTEPVEFNTEEQQEPISKSNCDESLMDQTMDTDLIPDQTESAKPQRQGNPLYDPLAEIYPEKLDQSLKADEKCRDHNDWISQCGCRANEERMNRTMHKSQTYEYVLVEESEDERSQHITQENSSTDQPAELVCRINPFPMLEYLQLSYEEAFFLVYALGCLSIYYNGEALSVAQLWTMFRSLQPNFCFSYAAYHYYRSKGWVPKSGVKYGTDLMLYRKGPPFYHASYSVVVDTVDASFRRSSLRPFSWRSLATLSRTTGNVSKELMLCFIITPSDVTGDLLVSPQCLKRFSVQEVLMSRWVSSKERTEQEEI.
For Research Use Only | Not For Clinical Use.
Online Inquiry