AibGenesis™ Mouse Anti-tspan18 Antibody (MO-AB-01821R)
Cat: MO-AB-01821R

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| MO-AB-01821R | Monoclonal | Medaka (Oryzias latipes), Cat (Felis catus), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Elephant (Loxodonta africana), Ferret (Mustela Putorius Furo), Frog (Xenopus laevis), Guinea pig (Cavia porcellus), Horse (Equus caballus), Mallard (Anas platyrhynchos), Marmoset, Nile tilapia (Oreochromis niloticus), O. anatinus (Ornithorhynchus anatinus), Pig (Sus scrofa), Rabbit (Oryctolagus cuniculus), Rat (Rattus norvegicus), Sheep (Ovis aries) | WB, ELISA | MO01821R | 100 µg | ||
| MO-AB-08286W | Monoclonal | Cat (Felis catus) | WB, ELISA | MO08286W | 100 µg | ||
| MO-AB-16005W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO16005W | 100 µg | ||
| MO-AB-33863W | Monoclonal | Dog (Canis lupus familiaris) | WB, ELISA | MO33863W | 100 µg | ||
| MO-AB-35891W | Monoclonal | Ferret (Mustela Putorius Furo) | WB, ELISA | MO35891W | 100 µg | ||
| MO-AB-42763W | Monoclonal | Guinea pig (Cavia porcellus) | WB, ELISA | MO42763W | 100 µg | ||
| MO-AB-46928W | Monoclonal | Horse (Equus caballus) | WB, ELISA | MO46928W | 100 µg | ||
| MO-AB-67018W | Monoclonal | Marmoset | WB, ELISA | MO67018W | 100 µg | ||
| MO-AB-22291R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO22291R | 100 µg | ||
| MO-AB-31012R | Monoclonal | Pig (Sus scrofa) | WB, ELISA | MO31012R | 100 µg | ||
| MO-AB-08781H | Monoclonal | Frog (Xenopus laevis) | WB, ELISA | MO08781C | 100 µg | ||
| MO-AB-23832H | Monoclonal | Mallard (Anas platyrhynchos) | WB, ELISA | MO23832C | 100 µg | ||
| MO-AB-29804H | Monoclonal | Rat (Rattus norvegicus) | WB, ELISA | MO29804C | 100 µg | ||
| MO-AB-33944H | Monoclonal | Nile tilapia (Oreochromis niloticus) | WB, ELISA | MO33944C | 100 µg | ||
| MO-AB-01557L | Monoclonal | Elephant (Loxodonta africana) | WB, ELISA | MO01557L | 100 µg | ||
| MO-AB-06959Y | Monoclonal | O. anatinus (Ornithorhynchus anatinus) | WB, ELISA | MO06959Y | 100 µg | ||
| MO-AB-10339Y | Monoclonal | Rabbit (Oryctolagus cuniculus) | WB, ELISA | MO10339Y | 100 µg | ||
| MO-AB-18076Y | Monoclonal | Sheep (Ovis aries) | WB, ELISA | MO18076Y | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Medaka (Oryzias latipes), Cat (Felis catus), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Elephant (Loxodonta africana), Ferret (Mustela Putorius Furo), Frog (Xenopus laevis), Guinea pig (Cavia porcellus), Horse (Equus caballus), Mallard (Anas platyrhynchos), Marmoset, Nile tilapia (Oreochromis niloticus), O. anatinus (Ornithorhynchus anatinus), Pig (Sus scrofa), Rabbit (Oryctolagus cuniculus), Rat (Rattus norvegicus), Sheep (Ovis aries) |
| Clone | MO01821R |
| Specificity | This antibody binds to Medaka tspan18. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
| Cellular Localization | Other locations; Plasma membrane |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Product Overview | This product is a mouse antibody against tspan18. It can be used for tspan18 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | Tetraspanin; LOC101168705 |
| UniProt ID | H2LIV3 |
| Protein Refseq | The length of the protein is 258 amino acids long. The sequence is show below: MGQGEASARGTTMEGDCLSCIKYLMFVFNFLIFLGGSFLLGVGVWVLVDPTGFREIVAANPLLFTGVYVILGMGGMLFLLGFLGCCGAIRENKCLLLFFFMLILLIFLAELAAAILAFIFREHLTREYFTKELKRHYQGYNNTDVFTSTWNAIMTTFDCCGVNSPEDFKDSRFRLINPNHVVPEACCLRVSQNGELAYTSRDQCLSGNMMFRNNKGCYSAVVDYFELYIYVAGALAIVVLTIELFAMVFAMCLFRGIQ. |
For Research Use Only | Not For Clinical Use.
Online Inquiry