AibGenesis™ Mouse Anti-TSPAN4 Antibody (MO-AB-04629Y)
Cat: MO-AB-04629Y

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| MO-AB-04629Y | Monoclonal | Chicken (Gallus gallus), Cat (Felis catus), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Ferret (Mustela Putorius Furo), Frog (Xenopus laevis), Guinea pig (Cavia porcellus), Horse (Equus caballus), Mallard (Anas platyrhynchos), Marmoset, Pig (Sus scrofa), Rat (Rattus norvegicus), Sheep (Ovis aries) | WB, ELISA | MO04629Y | 100 µg | ||
| MO-AB-07683W | Monoclonal | Cat (Felis catus) | WB, ELISA | MO07683W | 100 µg | ||
| MO-AB-08785H | Monoclonal | Frog (Xenopus laevis) | WB, ELISA | MO08785C | 100 µg | ||
| MO-AB-13288W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO13288W | 100 µg | ||
| MO-AB-18081Y | Monoclonal | Sheep (Ovis aries) | WB, ELISA | MO18081Y | 100 µg | ||
| MO-AB-22298R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO22298R | 100 µg | ||
| MO-AB-23835H | Monoclonal | Mallard (Anas platyrhynchos) | WB, ELISA | MO23835C | 100 µg | ||
| MO-AB-29809H | Monoclonal | Rat (Rattus norvegicus) | WB, ELISA | MO29809C | 100 µg | ||
| MO-AB-31016R | Monoclonal | Pig (Sus scrofa) | WB, ELISA | MO31016R | 100 µg | ||
| MO-AB-33867W | Monoclonal | Dog (Canis lupus familiaris) | WB, ELISA | MO33867W | 100 µg | ||
| MO-AB-35897W | Monoclonal | Ferret (Mustela Putorius Furo) | WB, ELISA | MO35897W | 100 µg | ||
| MO-AB-42767W | Monoclonal | Guinea pig (Cavia porcellus) | WB, ELISA | MO42767W | 100 µg | ||
| MO-AB-46932W | Monoclonal | Horse (Equus caballus) | WB, ELISA | MO46932W | 100 µg | ||
| MO-AB-67027W | Monoclonal | Marmoset | WB, ELISA | MO67027W | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Chicken (Gallus gallus), Cat (Felis catus), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Ferret (Mustela Putorius Furo), Frog (Xenopus laevis), Guinea pig (Cavia porcellus), Horse (Equus caballus), Mallard (Anas platyrhynchos), Marmoset, Pig (Sus scrofa), Rat (Rattus norvegicus), Sheep (Ovis aries) |
| Clone | MO04629Y |
| Specificity | This antibody binds to Chicken TSPAN4. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
| Cellular Localization | Plasma membrane; Other locations |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | The protein encoded by this gene is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility. This encoded protein is a cell surface glycoprotein and is similar in sequence to its family member CD53 antigen. It is known to complex with integrins and other transmembrane 4 superfamily proteins. Alternatively spliced transcript variants encoding different isoforms have been identified. (From NCBI) |
| Product Overview | This product is a mouse antibody against TSPAN4. It can be used for TSPAN4 detection in Western Blot and Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | Tetraspanin; TSPAN4 |
| UniProt ID | E1BVM3 |
| Protein Refseq | The length of the protein is 238 amino acids long. The sequence is show below: APFSLLTCQKSLYYCFSVRFFLGGCGILGVGIWLAVTQGNFATLSSSFPSLSAANLLIVTGTFVMIIGFVGCIGAIKENKCLLLSFFIMLLIVFLLELTVVILFFVYTDKIDKYAQRDLKKGLHLYGTDGNIGLTNAWSIIQTDFRCCGVSNYTDWFEVYNTTRVPDSCCLEFSENCGLHSPGTWWKDSCYEAVKIWLQENLLAVGIFGLCTVLVQILGLTFAMTMYCQVVKADTYCA. |
For Research Use Only | Not For Clinical Use.
Online Inquiry