AibGenesis™ Mouse Anti-TSPAN4 Antibody (MO-AB-04629Y)


Cat: MO-AB-04629Y

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-04629Y Monoclonal Chicken (Gallus gallus), Cat (Felis catus), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Ferret (Mustela Putorius Furo), Frog (Xenopus laevis), Guinea pig (Cavia porcellus), Horse (Equus caballus), Mallard (Anas platyrhynchos), Marmoset, Pig (Sus scrofa), Rat (Rattus norvegicus), Sheep (Ovis aries) WB, ELISA MO04629Y 100 µg
MO-AB-07683W Monoclonal Cat (Felis catus) WB, ELISA MO07683W 100 µg
MO-AB-08785H Monoclonal Frog (Xenopus laevis) WB, ELISA MO08785C 100 µg
MO-AB-13288W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO13288W 100 µg
MO-AB-18081Y Monoclonal Sheep (Ovis aries) WB, ELISA MO18081Y 100 µg
MO-AB-22298R Monoclonal Cattle (Bos taurus) WB, ELISA MO22298R 100 µg
MO-AB-23835H Monoclonal Mallard (Anas platyrhynchos) WB, ELISA MO23835C 100 µg
MO-AB-29809H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO29809C 100 µg
MO-AB-31016R Monoclonal Pig (Sus scrofa) WB, ELISA MO31016R 100 µg
MO-AB-33867W Monoclonal Dog (Canis lupus familiaris) WB, ELISA MO33867W 100 µg
MO-AB-35897W Monoclonal Ferret (Mustela Putorius Furo) WB, ELISA MO35897W 100 µg
MO-AB-42767W Monoclonal Guinea pig (Cavia porcellus) WB, ELISA MO42767W 100 µg
MO-AB-46932W Monoclonal Horse (Equus caballus) WB, ELISA MO46932W 100 µg
MO-AB-67027W Monoclonal Marmoset WB, ELISA MO67027W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityChicken (Gallus gallus), Cat (Felis catus), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Ferret (Mustela Putorius Furo), Frog (Xenopus laevis), Guinea pig (Cavia porcellus), Horse (Equus caballus), Mallard (Anas platyrhynchos), Marmoset, Pig (Sus scrofa), Rat (Rattus norvegicus), Sheep (Ovis aries)
CloneMO04629Y
SpecificityThis antibody binds to Chicken TSPAN4.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationPlasma membrane; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility. This encoded protein is a cell surface glycoprotein and is similar in sequence to its family member CD53 antigen. It is known to complex with integrins and other transmembrane 4 superfamily proteins. Alternatively spliced transcript variants encoding different isoforms have been identified. (From NCBI)
Product OverviewThis product is a mouse antibody against TSPAN4. It can be used for TSPAN4 detection in Western Blot and Enzyme-Linked Immunosorbent Assay.
Alternative NamesTetraspanin; TSPAN4
UniProt IDE1BVM3
Protein RefseqThe length of the protein is 238 amino acids long. The sequence is show below: APFSLLTCQKSLYYCFSVRFFLGGCGILGVGIWLAVTQGNFATLSSSFPSLSAANLLIVTGTFVMIIGFVGCIGAIKENKCLLLSFFIMLLIVFLLELTVVILFFVYTDKIDKYAQRDLKKGLHLYGTDGNIGLTNAWSIIQTDFRCCGVSNYTDWFEVYNTTRVPDSCCLEFSENCGLHSPGTWWKDSCYEAVKIWLQENLLAVGIFGLCTVLVQILGLTFAMTMYCQVVKADTYCA.
For Research Use Only | Not For Clinical Use.
Online Inquiry