AibGenesis™ Mouse Anti-TSTD1 Antibody (CBMOAB-61408FYA)


Cat: CBMOAB-61408FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-61408FYA Monoclonal Rhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset, Rat (Rattus norvegicus) WB, ELISA MO61408FYA 100 µg
MO-AB-06744W Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO06744W 100 µg
MO-AB-08794H Monoclonal Frog (Xenopus laevis) WB, ELISA MO08794C 100 µg
MO-AB-12308W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO12308W 100 µg
MO-AB-29822H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO29822C 100 µg
MO-AB-67057W Monoclonal Marmoset WB, ELISA MO67057W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset, Rat (Rattus norvegicus)
CloneMO61408FYA
SpecificityThis antibody binds to Rhesus TSTD1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationOther locations; Cytosol

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus TSTD1 Antibody is a mouse antibody against TSTD1. It can be used for TSTD1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesTSTD1
UniProt IDF6V1M5
Protein RefseqThe length of the protein is 120 amino acids long.
The sequence is show below: EGCRALSSAPTVSLPELRSLLASGRARLFDVRSREEAAAGTIPGALNIPVSELESALQMEPAAFQALYSAEKPKLEDEHLVFFCQMGKRGLQAMQLARSLGYTGARNYAGAYREWLEKEG.
For Research Use Only | Not For Clinical Use.
Online Inquiry