AibGenesis™ Mouse Anti-ttc9c Antibody (CBMOAB-11142FYB)


Cat: CBMOAB-11142FYB

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-11142FYB Monoclonal Zebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Goat (Capra hircus), Horse (Equus caballus), Marmoset, Rat (Rattus norvegicus) WB, ELISA MO11142FYB 100 µg
MO-AB-16196W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO16196W 100 µg
MO-AB-22351R Monoclonal Cattle (Bos taurus) WB, ELISA MO22351R 100 µg
MO-AB-29836H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO29836C 100 µg
MO-AB-38370W Monoclonal Goat (Capra hircus) WB, ELISA MO38370W 100 µg
MO-AB-46944W Monoclonal Horse (Equus caballus) WB, ELISA MO46944W 100 µg
MO-AB-67109W Monoclonal Marmoset WB, ELISA MO67109W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Goat (Capra hircus), Horse (Equus caballus), Marmoset, Rat (Rattus norvegicus)
CloneMO11142FYB
SpecificityThis antibody binds to Zebrafish ttc9c.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Zebrafish ttc9c Antibody is a mouse antibody against ttc9c. It can be used for ttc9c detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesZgc:56497; ttc9c; zgc:5649
UniProt IDQ7ZUI3
Protein RefseqThe length of the protein is 217 amino acids long.
The sequence is show below: MDEKVADPPAGDDGSSCLGAAGGSSASRLDSQLQEAVRLKTEGNAFYRGRNVRSAIGRYHRALLVLRSLDSEVNSVMQGFGAPVPKLNQEQDELLRSTQIDCYNNLAACLLQRELVDYTRVLEYSLKVLHWRPADTKALYRAGVASLELGDAPAARQYLTQASRGKPNDADVKKQLQRVEERLSQDYQKEKALYKGMFSKQKQAEEQIAEEKTRELV.
For Research Use Only | Not For Clinical Use.
Online Inquiry