AibGenesis™ Mouse Anti-Ttm3 Antibody (CBMOAB-33655FYA)


Cat: CBMOAB-33655FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-33655FYA Monoclonal Fruit fly (Drosophila melanogaster), A. thaliana (Arabidopsis thaliana) WB, ELISA MO33655FYA 100 µg
CBMOAB-45366FYC Monoclonal A. thaliana (Arabidopsis thaliana) WB, ELISA MO45366FC 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFruit fly (Drosophila melanogaster), A. thaliana (Arabidopsis thaliana)
CloneMO33655FYA
SpecificityThis antibody binds to fruit fly Ttm3.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationMitochondrion; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-D. melanogaster Ttm3 Antibody is a mouse antibody against Ttm3. It can be used for Ttm3 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesMitochondrial import inner membrane translocase subunit TIM50-A; Tiny tim 3; ttm3
UniProt IDQ9V9P3
Protein RefseqThe length of the protein is 343 amino acids long.
The sequence is show below: MHKIVWFGTLNKSIGYIGKKKTCLLSPCEKICLNSARKTVQRCDKNYSPPKLRRIKNFYTYSVVLGSLFSIVMWAIYKLGKPEEDHRGPIEDEFSQLPWFRQYIMRMWHTLQYYEKMMEEPQMARLLPNVVPPPYIQPPYSLVLEIKDVLVHPDWTYQTGWRFKKRPGVDYFLQQCSRNFEIVIYTSEQGMTAFPLLDALDPYGYIKYRLVRGATDLVEGQHTKNLDYLNRDLSRVIVVDCDPYTTPLHPDNSLVLTKWLGNDDDVQLFDLTAFLQLIAEHQVNDVREVLRYYRQFEDPMEQFKDNQRRLQEQSQESIQNLPTSERQWNLTLLGRSLRGSSIK.
For Research Use Only | Not For Clinical Use.
Online Inquiry