AibGenesis™ Mouse Anti-ttpal Antibody (CBMOAB-11201FYB)


Cat: CBMOAB-11201FYB

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-11201FYB Monoclonal Zebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Rhesus (Macaca mulatta) WB, ELISA MO11201FYB 100 µg
CBMOAB-61543FYA Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO61543FYA 100 µg
MO-AB-22368R Monoclonal Cattle (Bos taurus) WB, ELISA MO22368R 100 µg
MO-AB-23510W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO23510W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Rhesus (Macaca mulatta)
CloneMO11201FYB
SpecificityThis antibody binds to Zebrafish ttpal.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Zebrafish ttpal Antibody is a mouse antibody against ttpal. It can be used for ttpal detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative Namesttpal; TTPAL Gene(Protein Coding) Alpha Tocopherol Transfer Protein Like
UniProt IDF1QZD8
Protein RefseqThe length of the protein is 341 amino acids long.
The sequence is show below: MADQNGHIDLGPPRDTAAGLGFPGPPPPIYTCTLTPELVAKAREELQEKPEWRLRDVQALRDMILKDHPNLRTRLDDAFLLRFLRARKFDYDRALQLLLNYHASRRAWPEVFQDLKPSTVKHVLDLGFLTVLPRPDPQGRYILCLRPGKWKPNDYPFVDNIRAIYLTLEKLIQPEETQVNGVVILVDYAGVGLSQASNPGPLLAKKVVGILQDGFPIRIKAVNIINEPRIFKGIFAIIKPFLKEKMAERYVLHGSDLASLHRVIPQSVLPQEYGGVSGRLDMSAWSRTLLEAEEEFVVEFCQPDPLEGVIMPDALLFEGEQGGAHGEDSFRHLRSQLYYCY.
For Research Use Only | Not For Clinical Use.
Online Inquiry