AibGenesis™ Mouse Anti-TXNDC2 Antibody (CBMOAB-61602FYA)


Cat: CBMOAB-61602FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-61602FYA Monoclonal Rhesus (Macaca mulatta), Horse (Equus caballus) WB, ELISA MO61602FYA 100 µg
MO-AB-46962W Monoclonal Horse (Equus caballus) WB, ELISA MO46962W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Horse (Equus caballus)
CloneMO61602FYA
SpecificityThis antibody binds to Rhesus TXNDC2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus TXNDC2 Antibody is a mouse antibody against TXNDC2. It can be used for TXNDC2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesTXNDC2
UniProt IDF6V6L1
Protein RefseqThe length of the protein is 317 amino acids long.
The sequence is show below: MDVDKELVMESVKAGAPGKPEMRLGSQEETNEGDANESSLQVLSSNVPLLALEFLDTVQAKEKAFLPMVSHTFHMPTEESGVEEAIQPKEGDIPKSPPEAIPPKAGDILKSPEEAIQPKEDDSPKSPEESIQPKEGDIPKSPEEAIPPKEDDILKSPEEAVQPKEGDIPKSPEEAIQPKEDDSTKSIEETIPPKEGDILKPEEETTEFLEGDKVKVILSKEDFEASLKEAGERLVAVDFSATWCGPCRTIKPFFHALSMKHEDVVFLEVDADDCEEVVRDCAIMCVPTFQFYKKEEKVDEFCGALKEKLETVIAELK.
For Research Use Only | Not For Clinical Use.
Online Inquiry