AibGenesis™ Mouse Anti-Txndc4 Antibody (MO-AB-08836H)


Cat: MO-AB-08836H

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-08836H Monoclonal Frog (Xenopus laevis), Pig (Sus scrofa) WB, ELISA MO08836C 100 µg
MO-AB-31053R Monoclonal Pig (Sus scrofa) WB, ELISA MO31053R 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFrog (Xenopus laevis), Pig (Sus scrofa)
CloneMO08836C
SpecificityThis antibody binds to Frog Txndc4.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationOther locations; Endoplasmic reticulum

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewThis product is a mouse antibody against Txndc4. It can be used for Txndc4 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesTxndc4 protein; Txndc4
UniProt IDQ7ZTP5
Protein RefseqThe length of the protein is 350 amino acids long.
The sequence is show below: FSNISRHIATNMRRYSFVPYFYPAYFFMLLIMCVFTPVKSEIITLESGNIDDILRNADVALVNFYADWCRFSQMLHPIFEEASNIIQEEYPDKNKVVFARVDCDQHSEIAQRYRISKYPTLKLFRNGMMMKREYRGQRSVTAIADYIRQQKSNPIREVGDLEELKTVDRSKRNIIGFFESKETDNFRTFEKVSNILHDDCVFLAAFGDVAKPERFSGDNVIYRPIGENAPDMVYLGSLTNFDLTFAWTQDKCVPLVREITFENGEELTEEGLPFLILFHVKDDTASLEKFQQEVARQLISEKGTINFLHADCEKFRHPLLHIQKTPADCPVIAIDSFRHMYVFPDFKDLS.
For Research Use Only | Not For Clinical Use.
Online Inquiry