AibGenesis™ Mouse Anti-ubfd1 Antibody (CBMOAB-11545FYB)


Cat: CBMOAB-11545FYB

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-11545FYB Monoclonal Zebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset WB, ELISA MO11545FYB 100 µg
MO-AB-10389W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO10389W 100 µg
MO-AB-22527R Monoclonal Cattle (Bos taurus) WB, ELISA MO22527R 100 µg
MO-AB-67315W Monoclonal Marmoset WB, ELISA MO67315W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset
CloneMO11545FYB
SpecificityThis antibody binds to Zebrafish ubfd1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Zebrafish ubfd1 Antibody is a mouse antibody against ubfd1. It can be used for ubfd1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative Namesubfd1; Ubiquitin Family Domain Containing 1
UniProt IDF1QUJ9
Protein RefseqThe length of the protein is 290 amino acids long.
The sequence is show below: MAAQDGSEVVGMEAEVTQKVPEVLCEAAGQGDEAGSEATSLTDGESTSAEPAAVSNGEESDEGKEMVDVKIIWNKNKYDLKIPLDGTGAKLKEKIHALTGLPPAMQKVMYKGLLPEEKTLREIKVTNGAKIMVVGSTINDVLAVNTPKEVIQQEVKAEENKKEPLCRQKQHRKVLDKGKPDDVMSSIKGAKERLPTVPLSGMYNKSGGKVRLTFKLEQDQLWIGTKERTEKIPMGSIKNVVTEPIEGHEDYHMMAFQLGPTEASQYWVYWVPAQFVDAIKDTVLGKWQYF.
For Research Use Only | Not For Clinical Use.
Online Inquiry