AibGenesis™ Mouse Anti-ucma Antibody (CBMOAB-11650FYB)


Cat: CBMOAB-11650FYB

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-11650FYB Monoclonal Zebrafish (Danio rerio), Rat (Rattus norvegicus), Rhesus (Macaca mulatta) WB, ELISA MO11650FYB 100 µg
CBMOAB-61776FYA Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO61776FYA 100 µg
MO-AB-29910H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO29910C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Rat (Rattus norvegicus), Rhesus (Macaca mulatta)
CloneMO11650FYB
SpecificityThis antibody binds to Zebrafish ucma.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationExtracellular region or secreted

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a chondrocyte-specific, highly charged protein that is abundantly expressed in the upper immature zone of fetal and juvenile epiphyseal cartilage. The encoded protein undergoes proteolytic processing to generate a mature protein that is secreted into the extracellular matrix. The glutamic acid residues in the encoded protein undergo gamma carboxylation in a vitamin K-dependent manner. Undercarboxylation of the encoded protein is associated with osteoarthritis in humans. Alternative splicing results in multiple transcript variants encoding different isoforms. (From NCBI)
Product OverviewMouse Anti-Zebrafish ucma Antibody is a mouse antibody against ucma. It can be used for ucma detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesUnique cartilage matrix-associated protein; [Cleaved into: Unique cartilage matrix-associated protein C-terminal fragment (Ucma-C) (Gla-rich protein) (GRP)]; ucm
UniProt IDQ6NWB6
Protein RefseqThe length of the protein is 135 amino acids long.
The sequence is show below: MSWTQPALLTCLLVLSAITLFDGADSAVSDKRDAVNPQGALRKIFMPEADAASFFKRRSRRAVKTQDEINAEQRQRLAADERRREYHEEQRNKYENYAEEENDEQDERTREKTEQWREFHYDGLDPSYEYNRHTI.
For Research Use Only | Not For Clinical Use.
Online Inquiry