AibGenesis™ Mouse Anti-ugt1a7 Antibody (CBMOAB-11702FYB)


Cat: CBMOAB-11702FYB

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-11702FYB Monoclonal Zebrafish (Danio rerio), Rabbit (Oryctolagus cuniculus), Rat (Rattus norvegicus) WB, ELISA MO11702FYB 100 µg
MO-AB-10393Y Monoclonal Rabbit (Oryctolagus cuniculus) WB, ELISA MO10393Y 100 µg
MO-AB-29921H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO29921C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Rabbit (Oryctolagus cuniculus), Rat (Rattus norvegicus)
CloneMO11702FYB
SpecificityThis antibody binds to Zebrafish ugt1a7.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a UDP-glucuronosyltransferase, an enzyme of the glucuronidation pathway that transforms small lipophilic molecules, such as steroids, bilirubin, hormones, and drugs, into water-soluble, excretable metabolites. This gene is part of a complex locus that encodes several UDP-glucuronosyltransferases. The locus includes thirteen unique alternate first exons followed by four common exons. Four of the alternate first exons are considered pseudogenes. Each of the remaining nine 5' exons may be spliced to the four common exons, resulting in nine proteins with different N-termini and identical C-termini. Each first exon encodes the substrate binding site, and is regulated by its own promoter. The enzyme encoded by this gene has moderate glucuronidase activity with phenols. (From NCBI)
Product OverviewMouse Anti-Zebrafish ugt1a7 Antibody is a mouse antibody against ugt1a7. It can be used for ugt1a7 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesUDP glucuronosyltransferase 1 family polypeptide a7 isoform 1; ugt1a7; Ugt1a
UniProt IDD3XD58
Protein RefseqThe length of the protein is 527 amino acids long.
The sequence is show below: MNDRIVRMAASALVLCLFCLVSAEAGNLLVIPALGSHWTGTRPLVEELGRRGNRVVVVFPEENVNMVPAKHTTTLTYPVPYTKAQIQKGTDAAISKLFSADVSSDVGRFQNFFTTMDMLKVIISRNAEGLLLNKDLLKKLQDYNFDAILTDPFETVGVIASEYLSIPAIYMQTSHPCGADVLASQCPAPPSYVPKGLTHFTDRMNLWQRSVNFVRTLVQPVACSRMFAHADEIASKVLQKKTSVMEIMSRAALWFMHFDFAFEFPRPVMPNMVVIGGVDTKKPEPLSQELEEFVNGSGEHGFVVFTLGSMVSQLPEAKAREFFEAFRQIPQRVLWRYTGPVPENAPKNVKLMKWLPQNDLLGHPKVRAFVTHGGSHGIYEGICNGVPMVMLPLFGDQGDNAQRLVSRGVAESLTIYDVTSEKLLVALKKVINDKSYKEKMMKLSAIHRDRPIEPLDLAVFWTEFVMRHKGAEHLRPAAHDLNWIQYHSLDVIGFLLLILLTVIFVTVKSCMFCFRKCFKKSQKKKKA.
For Research Use Only | Not For Clinical Use.
Online Inquiry