AibGenesis™ Mouse Anti-ULBP4 Antibody (CBMOAB-61835FYA)


Cat: CBMOAB-61835FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-61835FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus) WB, ELISA MO61835FYA 100 µg
MO-AB-22592R Monoclonal Cattle (Bos taurus) WB, ELISA MO22592R 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus)
CloneMO61835FYA
SpecificityThis antibody binds to Rhesus ULBP4.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus ULBP4 Antibody is a mouse antibody against ULBP4. It can be used for ULBP4 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesUL-16 binding protein 4; ULBP4
UniProt IDF8WL23
Protein RefseqThe length of the protein is 178 amino acids long.
The sequence is show below: AHSLCFNFTIKSWSRPGQPWCEAQVFMNKNLFLQYDSDSNMVKPLGLLGKKVNATSTWGELTQTLGEVGRDLRMLLLDVKPQIKTSGPSTLQVEMLCQREAERCTGASWQFTINGEKCLLFDAMNITWTVINHEASKIKETWKNDRGLEKYFRKLSMGDCNHWLREFLGHQEAMPEPT.
For Research Use Only | Not For Clinical Use.
Online Inquiry