AibGenesis™ Mouse Anti-uox Antibody (CBMOAB-15391FYB)


Cat: CBMOAB-15391FYB

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-15391FYB Monoclonal Zebrafish (Danio rerio), Cattle (Bos taurus), Dog (Canis lupus familiaris), Frog (Xenopus laevis), Rabbit (Oryctolagus cuniculus) WB, ELISA MO15391FYB 100 µg
MO-AB-08939H Monoclonal Frog (Xenopus laevis) WB, ELISA MO08939C 100 µg
MO-AB-10401Y Monoclonal Rabbit (Oryctolagus cuniculus) WB, ELISA MO10401Y 100 µg
MO-AB-22610R Monoclonal Cattle (Bos taurus) WB, ELISA MO22610R 100 µg
MO-AB-33941W Monoclonal Dog (Canis lupus familiaris) WB, ELISA MO33941W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Cattle (Bos taurus), Dog (Canis lupus familiaris), Frog (Xenopus laevis), Rabbit (Oryctolagus cuniculus)
CloneMO15391FYB
SpecificityThis antibody binds to Zebrafish uox.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Zebrafish uox Antibody is a mouse antibody against uox. It can be used for uox detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesUricase; EC 1.7.3.3; Urate oxidase; uo
UniProt IDE9QGD6
Protein RefseqThe length of the protein is 305 amino acids long.
The sequence is show below: MATTSNQNVEFVRTGYGKNMVKVLHIRREGNHHHIIELIANVQLTLKTRKDYLTGDNSDIIPTDTVKNTVHALAKLKGIKSIESFALDICEHFLTAFNHVTRVKVNIDEVPWKRLEKNGVEHNHAFIHCPEALRFCEAEQYLSKTPVVHSGLKDMKVLKTTQTGFEGFLRDRFTTLTDAKDRFFCTSVYARWRYNTINVAFDAAWKAVKDTVIQKFAGPYDRGEYSPSVQKTLYDTQLLVLDRIPEVEEIEIIMPNQHYFVIDMTKIGLSNKDEETSQALCAENHEPECEDKQPSRTRHLMYTNQ.
For Research Use Only | Not For Clinical Use.
Online Inquiry