AibGenesis™ Mouse Anti-uqcc2 Antibody (CBMOAB-15417FYB)


Cat: CBMOAB-15417FYB

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-15417FYB Monoclonal Zebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Rat (Rattus norvegicus) WB, ELISA MO15417FYB 100 µg
MO-AB-08950H Monoclonal Frog (Xenopus laevis) WB, ELISA MO08950C 100 µg
MO-AB-11112W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO11112W 100 µg
MO-AB-22629R Monoclonal Cattle (Bos taurus) WB, ELISA MO22629R 100 µg
MO-AB-29926H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO29926C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Rat (Rattus norvegicus)
CloneMO15417FYB
SpecificityThis antibody binds to Zebrafish uqcc2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationMitochondrion

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a nucleoid protein localized to the mitochondria inner membrane. The encoded protein affects regulation of insulin secretion, mitochondrial ATP production, and myogenesis through modulation of mitochondrial respiratory chain activity. (From NCBI)
Product OverviewMouse Anti-Zebrafish uqcc2 Antibody is a mouse antibody against uqcc2. It can be used for uqcc2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesUbiquinol-cytochrome-c reductase complex assembly factor 2; Mitochondrial nucleoid factor 1; Mitochondrial protein M19; uqcc2; mnf
UniProt IDQ6PBU7
Protein RefseqThe length of the protein is 129 amino acids long.
The sequence is show below: MSATRYRRFLKLCEEWPKDESKKGRDLGTFLRQRVASAFREGENTQISDPEKCDQMYESLARINSNVYKEKFPRAKDTSFTGVTVEECRLLLATGSMQQTDEEKKGLWKTLMERFSSKPEDVPPEKAEK.
For Research Use Only | Not For Clinical Use.
Online Inquiry