AibGenesis™ Mouse Anti-uxs1 Antibody (CBMOAB-15620FYB)


Cat: CBMOAB-15620FYB

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-15620FYB Monoclonal Zebrafish (Danio rerio), A. thaliana (Arabidopsis thaliana), Arabidopsis (Arabidopsis lyrata), Chimpanzee (Pan troglodytes), Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus), Pig (Sus scrofa), Cattle (Bos taurus), Primate, Marmoset, Rhesus (Macaca mulatta) WB, ELISA MO15620FYB 100 µg
CBMOAB-45779FYC Monoclonal A. thaliana (Arabidopsis thaliana) WB, ELISA MO45779FC 100 µg
CBMOAB-62036FYA Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO62036FYA 100 µg
MO-AB-01038H Monoclonal Arabidopsis (Arabidopsis lyrata) WB, ELISA MO01038C 100 µg
MO-AB-26341W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO26341W 100 µg
MO-AB-67604W Monoclonal Marmoset WB, ELISA MO67604W 100 µg
MO-DKB-03343W Polyclonal Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus), Pig (Sus scrofa), Cattle (Bos taurus), Primate, Zebrafish (Danio rerio) WB, IHC, IHC-P 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), A. thaliana (Arabidopsis thaliana), Arabidopsis (Arabidopsis lyrata), Chimpanzee (Pan troglodytes), Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus), Pig (Sus scrofa), Cattle (Bos taurus), Primate, Marmoset, Rhesus (Macaca mulatta)
CloneMO15620FYB
SpecificityThis antibody binds to Zebrafish uxs1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationGolgi apparatus; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes an enzyme found in the perinuclear Golgi which catalyzes the synthesis of UDP-xylose used in glycosaminoglycan (GAG) synthesis on proteoglycans. The GAG chains are covalently attached to proteoglycans which participate in signaling pathways during development. Multiple transcript variants encoding different isoforms have been found for this gene. (From NCBI)
Product OverviewMouse Anti-Zebrafish uxs1 Antibody is a mouse antibody against uxs1. It can be used for uxs1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesUDP-glucuronic acid decarboxylase 1; EC 4.1.1.35; UDP-glucuronate decarboxylase 1; UXS-1; uxs
UniProt IDQ6GMI9
Protein RefseqThe length of the protein is 418 amino acids long.
The sequence is show below: MMRMSWMVTVINRRMMKILIALALIAYIASVWGTYANMRSIQEHGEMKIEQRIDEAVGPLREKIRELELSFTQKYPPVKFLSEKDRKRILITGGAGFVGSHLTDKLMMDGHEVTVVDNFFTGRKRNVEHWIGHENFELINHDVVEPLYIEVDQIYHLASPASPPNYMYNPIKTLKTNTIGTLNMLGLAKRVGARLLLASTSEVYGDPEVHPQNEDYWGHVNPIGPRACYDEGKRVAETMCYAYMKQEGVEVRVARIFNTFGSRMHMNDGRVVSNFILQALQGEALTVYGSGSQTRAFQYVSDLVNGLVSLMNSNISSPVNLGNPEEHTILEFAQLIKSLVASRSHIQFLPEAQDDPQRRRPDIRKAKLLLGWEPVVPLEEGLNKTIQYFSRELEHQANNQYIPKPKAARMKKGRPRHN.
For Research Use Only | Not For Clinical Use.
Online Inquiry