AibGenesis™ Mouse Anti-vamp5 Antibody (CBMOAB-15672FYB)


Cat: CBMOAB-15672FYB

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-15672FYB Monoclonal Zebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), O. mykiss (Oncorhynchus mykiss), Rat (Rattus norvegicus) WB, ELISA MO15672FYB 100 µg
MO-AB-12108W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO12108W 100 µg
MO-AB-13638Y Monoclonal O. mykiss (Oncorhynchus mykiss) WB, ELISA MO13638Y 100 µg
MO-AB-22737R Monoclonal Cattle (Bos taurus) WB, ELISA MO22737R 100 µg
MO-AB-29953H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO29953C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), O. mykiss (Oncorhynchus mykiss), Rat (Rattus norvegicus)
CloneMO15672FYB
SpecificityThis antibody binds to Zebrafish vamp5.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationPlasma Membrane; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionSynaptobrevins/VAMPs, syntaxins, and the 25-kD synaptosomal-associated protein are the main components of a protein complex involved in the docking and/or fusion of vesicles and cell membranes. The VAMP5 gene is a member of the vesicle-associated membrane protein (VAMP)/synaptobrevin family and the SNARE superfamily. This VAMP family member may participate in vesicle trafficking events that are associated with myogenesis. (From NCBI)
Product OverviewMouse Anti-Zebrafish vamp5 Antibody is a mouse antibody against vamp5. It can be used for vamp5 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative Namesvamp5; si:dkeyp-86b9.2; Vesicle Associated Membrane Protein 5
UniProt IDA2BG37
Protein RefseqThe length of the protein is 112 amino acids long.
The sequence is show below: MQNGNSRLSEAQKDVEEVKGIMLDNLNKAEERSGKLKELETRADDLLVKGKAFSKTATKVKQKKRWENIKYKVVIAAVAAAVLLGIILAVALSFSNDDNGKDASTTTTTKAP.
For Research Use Only | Not For Clinical Use.
Online Inquiry