AibGenesis™ Mouse Anti-VGLL2 Antibody (CBMOAB-62082FYA)


Cat: CBMOAB-62082FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-62082FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chicken (Gallus gallus), Frog (Xenopus laevis), Pig (Sus scrofa) WB, ELISA MO62082FYA 100 µg
MO-AB-04738Y Monoclonal Chicken (Gallus gallus) WB, ELISA MO04738Y 100 µg
MO-AB-09042H Monoclonal Frog (Xenopus laevis) WB, ELISA MO09042C 100 µg
MO-AB-22781R Monoclonal Cattle (Bos taurus) WB, ELISA MO22781R 100 µg
MO-AB-31190R Monoclonal Pig (Sus scrofa) WB, ELISA MO31190R 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chicken (Gallus gallus), Frog (Xenopus laevis), Pig (Sus scrofa)
CloneMO62082FYA
SpecificityThis antibody binds to Rhesus VGLL2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a protein with a transcriptional enhancer factor 1 (TEF-1) interaction domain. The encoded protein may act as a co-factor of TEF-1 regulated gene expression during skeletal muscle development. Alternatively spliced transcript variants encoding multiple isoforms have been observed. (From NCBI)
Product OverviewMouse Anti-Rhesus VGLL2 Antibody is a mouse antibody against VGLL2. It can be used for VGLL2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesVGLL2
UniProt IDF7HAQ3
Protein RefseqThe length of the protein is 317 amino acids long.
The sequence is show below: MSCLDVMYQVYGPPQPYFAAAYTPYHQKLAYYSKMQEAQECNASPSSSGSGSSSFSSQTPASIKEEEGSPEKERPPEAEYINSRCVLFTYFQGDISSVVDEHFSRALSQPSSYSPSCTSSKTPRSSGPWRDCSFPMSQRSFPASFWNSAYQAPVPAPLGSPLATAHSELPFAAADPYSPAALHGHLHQGATEPWHHAHPHHAHPHHPYALGGALGAQAAPYPRPAAVHEVYAPHFDPRYGPLLMPAASGRPTRLAPAPAPAPGSPPCELSGKGEPAGAAWAGPGGPFSSSSGDVAQGLGLSVDSARRYSLCGASLLS.
For Research Use Only | Not For Clinical Use.
Online Inquiry