AibGenesis™ Mouse Anti-Vpreb3 Antibody (MO-AB-29988H)


Cat: MO-AB-29988H

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-29988H Monoclonal Rat (Rattus norvegicus), Ferret (Mustela Putorius Furo) WB, ELISA MO29988C 100 µg
Inquiry
MO-AB-35974W Monoclonal Ferret (Mustela Putorius Furo) WB, ELISA MO35974W 100 µg
Inquiry

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRat (Rattus norvegicus), Ferret (Mustela Putorius Furo)
CloneMO29988C
SpecificityThis antibody binds to Rat Vpreb3.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationExtracellular region or secreted

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene is the human ortholog of the mouse VpreB3 (8HS20) protein, is thought to be involved in B-cell maturation, and may play a role in assembly of the pre-B cell receptor (pre-BCR). While the role of this protein in B-cell development has not yet been elucidated, studies with the chicken ortholog of this protein have found that when overexpressed, this protein localizes to the endoplasmic reticulum. The mouse ortholog of this protein has been shown to associate with membrane mu heavy chains early in the course of pre-B cell receptor biosynthesis. Expression of this gene has been observed in some lymphomas. (From NCBI)
Product OverviewThis product is a mouse antibody against Vpreb3. It can be used for Vpreb3 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesPre-B lymphocyte gene 3, isoform CRA_b; Protein Vpreb3; Vpreb3
UniProt IDD3ZRL1
Protein RefseqThe length of the protein is 106 amino acids long.
The sequence is show below: MACPGYRPFLLVGAFLSGQEAQLSCTINSQQASVEDTGVSWYQQQPGGSPHFLYYHSKEEDYRPADIPDRFSATMDVVHNACVLTISPVLPEDDADYFCSIAHFEP.
For Research Use Only | Not For Clinical Use.
Online Inquiry